KEGG   Thermoanaerobacter kivui: TKV_c16320Help
Entry
TKV_c16320        CDS       T03397                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase TpiA
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tki  Thermoanaerobacter kivui
Pathway
tki00010  Glycolysis / Gluconeogenesis
tki00051  Fructose and mannose metabolism
tki01100  Metabolic pathways
tki01110  Biosynthesis of secondary metabolites
tki01120  Microbial metabolism in diverse environments
tki01130  Biosynthesis of antibiotics
tki01200  Carbon metabolism
tki01230  Biosynthesis of amino acids
Module
tki_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
tki_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:tki00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TKV_c16320 (tpiA)
   00051 Fructose and mannose metabolism
    TKV_c16320 (tpiA)
   00562 Inositol phosphate metabolism
    TKV_c16320 (tpiA)
Enzymes [BR:tki01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     TKV_c16320 (tpiA)
Exosome [BR:tki04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   TKV_c16320 (tpiA)
  Exosomal proteins of bladder cancer cells
   TKV_c16320 (tpiA)
  Exosomal proteins of melanoma cells
   TKV_c16320 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AIS52786
UniProt: A0A097ASI4
LinkDB All DBs
Position
complement(1557051..1557821)
Genome map
AA seq 256 aa AA seqDB search
MISKGVIILRRPIIAGNWKMHMTPSEAVKLVQELIPLVKDAKAEVVVIPPFVDLTEVSKV
IQGTNILLGAQNMFWEEKGAYTGEISPLMLKEIGVKYVIIGHSERRQYFGETDEMVNKKV
LSALSHGLNPIVCVGESLSQREEGKTYDVVLSQTKEALKGVSKEDIANVVIAYEPIWAIG
TGKTATAKDANEVIKAIRNTIAELYGKEKADLVRIQYGGSVKPSNASELMAESDIDGALV
GGASLVAADFAQIVNY
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgataagtaaaggggtgatcattttgagaagaccaataattgctggtaattggaaaatg
cacatgaccccttctgaagcggtgaagttagtgcaagagttgatacctttagtaaaagac
gcaaaagcagaagtagtagtcatacctccttttgtcgacttaacagaggtgagtaaagtt
atccaaggcacaaatatcctccttggggctcaaaatatgttttgggaagaaaaaggagcg
tatactggtgaaatttctcctctcatgcttaaagaaataggagtaaaatatgttataata
ggccattctgaaagaaggcagtattttggtgagactgatgaaatggtgaataaaaaagtt
ttatcagctttgtcccatggtttaaatcccatcgtttgtgtaggagaatctctttctcaa
agagaagagggtaaaacttatgatgtggttttaagtcaaactaaagaagcattaaaaggc
gtttctaaagaggatattgcgaatgtcgtaatagcttacgaacccatttgggctatcggt
actggcaaaacagctacagctaaagacgccaatgaagtcataaaagctataagaaatact
atagctgagctgtatggaaaagaaaaagcagatttggttagaatacaatatggaggaagt
gttaagccaagtaacgcttccgaacttatggcagaaagcgatattgacggtgctttagta
gggggagcaagccttgtagcagcagattttgcacaaattgtcaattattaa

DBGET integrated database retrieval system