KEGG   Thermoanaerobacter kivui: TKV_c16900Help
Entry
TKV_c16900        CDS       T03397                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase PfkA
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tki  Thermoanaerobacter kivui
Pathway
tki00010  Glycolysis / Gluconeogenesis
tki00030  Pentose phosphate pathway
tki00051  Fructose and mannose metabolism
tki00052  Galactose metabolism
tki00680  Methane metabolism
tki01100  Metabolic pathways
tki01110  Biosynthesis of secondary metabolites
tki01120  Microbial metabolism in diverse environments
tki01130  Biosynthesis of antibiotics
tki01200  Carbon metabolism
tki01230  Biosynthesis of amino acids
tki03018  RNA degradation
Module
tki_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tki00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TKV_c16900 (pfkA)
   00030 Pentose phosphate pathway
    TKV_c16900 (pfkA)
   00051 Fructose and mannose metabolism
    TKV_c16900 (pfkA)
   00052 Galactose metabolism
    TKV_c16900 (pfkA)
  09102 Energy metabolism
   00680 Methane metabolism
    TKV_c16900 (pfkA)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    TKV_c16900 (pfkA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:tki01009]
    TKV_c16900 (pfkA)
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:tki03019]
    TKV_c16900 (pfkA)
Enzymes [BR:tki01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     TKV_c16900 (pfkA)
Protein phosphatases and associated proteins [BR:tki01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     TKV_c16900 (pfkA)
Messenger RNA biogenesis [BR:tki03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     TKV_c16900 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: AIS52844
UniProt: A0A097ASQ5
LinkDB All DBs
Position
complement(1619520..1620485)
Genome map
AA seq 321 aa AA seqDB search
MKTIGILTSGGDAPGMNAAIRAVVRTGIYYGLKVKGIMRGFAGLVEDEVIDLNLSSVGDI
LQKGGTILRTARCEEFKKKEVRKKAYETLQKHGIEGLVVIGGDGSFRGAQLLSEEWNVNT
IGIPGTIDNDIPCTDYTIGFDTACNTVIDAINKIRDTATSHERANIIEVMGRNAGYIALY
AGVAGGAEMIILPEVEWSIDELCDKITYGIKRGKLHHIIVLAEGVMSAPELAKMIKERLP
KLDLRYTILGHIQRGGAPTVMDRVLASQMGARAVELLLENKTKRIISIRNNQIVDDDIDE
ALSMKKEFNRKLYELSKILSI
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaattgggatacttacaagtggtggagatgcaccagggatgaacgcagccata
agggctgtggtaagaacaggaatttattatgggcttaaagtaaagggaatcatgagagga
tttgcaggtttagtagaggatgaagttattgacctaaacctttcttctgtaggagatata
ttgcaaaaaggcggtactattttgaggactgccagatgtgaagaattcaagaaaaaagaa
gtgcgaaaaaaagcttatgaaactcttcaaaaacacggaatagaaggtttagtagttatt
ggaggagatgggtctttcagaggagcccaacttttgagtgaagagtggaatgtaaatact
attggaattcctggaacaattgataatgacattccttgtactgattatacaataggtttt
gatacagcgtgtaatacggttattgatgcaataaataaaataagagatacagctacttct
catgaaagagcaaatataatagaagtgatgggaagaaatgcgggttacattgctttgtat
gctggtgtagcaggaggagcagaaatgattatactccctgaggtggagtggagcattgat
gaactttgcgataaaattacttatgggataaaaagaggtaaacttcatcatataattgtc
cttgcagaaggagttatgagtgctccagaacttgcaaaaatgattaaggagaggttacct
aaattggatttaaggtatactattttgggacacattcaaagaggtggagctccgacagtg
atggacagagtgctggcaagccaaatgggagcaagagctgtagaattacttttggaaaac
aagacaaaaaggataataagcatacgaaataatcaaattgtggatgatgatatagacgaa
gctctctctatgaagaaagagtttaacagaaaattgtatgaattgagcaaaattttgtct
atataa

DBGET integrated database retrieval system