KEGG   Thermoanaerobacter kivui: TKV_c18920Help
Entry
TKV_c18920        CDS       T03397                                 

Gene name
alr2
Definition
(GenBank) alanine racemase 2
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
tki  Thermoanaerobacter kivui
Pathway
tki00473  D-Alanine metabolism
tki01100  Metabolic pathways
tki01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:tki00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    TKV_c18920 (alr2)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    TKV_c18920 (alr2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:tki01011]
    TKV_c18920 (alr2)
Enzymes [BR:tki01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     TKV_c18920 (alr2)
Peptidoglycan biosynthesis and degradation proteins [BR:tki01011]
 Precursor biosynthesis
  Racemase
   TKV_c18920 (alr2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AIS53041
UniProt: A0A097ATA1
LinkDB All DBs
Position
complement(1830370..1831539)
Genome map
AA seq 389 aa AA seqDB search
MVFDEIRPTRAEIYLDNIVNNLNEVKRLIGNKVKIMGVVKANAYGHGACQVAKVLIENGV
SYLAVATVDEALELRDCGIKSPILIFDYTPLTQAKDLIEYHITQTVFDIKYVRELGKMAL
NKGKKAKVHVKIDTGMGRIGYTDLEIAQREIEEMANMKGIELEGIFSHFSTSDEKDKTYS
EMQFDMFKKLLEKLKERKIDIPLKHIANSGAILDIEYSYLDMVRPGIILYGSYPSEEVQK
RANLKQTMSFKTKVVYVKEVPEGSYISYGRTFVTKRKSKIATLPVGYADGFNRLLSNNHH
VLIKGKYAPVVGRICMDQCMIDVTDVDNVEVGDEVVIFGMQQDKKITVDEIAKKLNTIPY
EVYCGISRRVPRIYIYKGEVLEVKNYLKI
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggtgtttgatgaaattaggcccacgagggcggagatataccttgacaatatagtgaac
aatttaaacgaagtcaaaaggttaataggaaataaagtgaagataatgggggttgtaaag
gcgaatgcttacggacatggagcttgtcaagtggcaaaggttttaatagaaaatggggtt
tcatacttggcagtggcaactgtagatgaagctttggaactaagagattgcggaattaaa
tctcctatccttatctttgactatactccactgacacaggctaaagacctaatagagtac
catataactcaaacggtttttgatataaagtatgtaagggaactgggaaaaatggcttta
aataaaggtaaaaaagcaaaggtccatgtcaaaattgacacgggaatgggacgaatcggg
tatacggatttggagatagctcagagagaaattgaagaaatggcaaatatgaagggaata
gaattggaaggtatattcagccatttttctacttcggatgaaaaagacaaaacttattct
gaaatgcaatttgacatgtttaaaaaattgttggaaaaacttaaagaaaggaaaatagat
attccattaaagcatattgcaaatagtggagctattcttgacattgagtacagttattta
gacatggtaagaccggggataattttgtatggcagttatccttcagaagaagtgcaaaaa
agagcgaatttaaagcaaacaatgtcatttaaaacaaaagtagtatacgtaaaagaagtg
ccagaagggtcatatataagttatggcagaacatttgtgacgaaaagaaaaagcaaaata
gcaaccctacctgttggatatgcagatggtttcaacagattgctgtcaaacaatcatcat
gtgttaataaaaggcaaatatgcaccagtagttggcagaatttgtatggaccagtgtatg
attgatgttactgatgtagataatgttgaggtgggagatgaagtagtaatttttggcatg
cagcaggataaaaagataactgttgatgaaatagctaaaaaactaaatactataccttat
gaagtatattgtggaatatcgaggagggtacctcgaatatatatttacaaaggggaagta
ctagaggtaaaaaattatttaaaaatttaa

DBGET integrated database retrieval system