KEGG   Thermoanaerobacter kivui: TKV_c23430Help
Entry
TKV_c23430        CDS       T03397                                 

Definition
(GenBank) amino acid permease
  KO
K03294  basic amino acid/polyamine antiporter, APA family
Organism
tki  Thermoanaerobacter kivui
Brite
KEGG Orthology (KO) [BR:tki00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    TKV_c23430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_permease_2 AA_permease Spore_permease AA_permease_C
Motif
Other DBs
NCBI-ProteinID: AIS53469
UniProt: A0A097AUG3
LinkDB All DBs
Position
2251416..2252723
Genome map
AA seq 435 aa AA seqDB search
MSKSNLFRKKTLEMVLSETEAAEYKLKKTLTAIDLIALGLGAIIGTGIFVITGVAAAEKA
GPAIVLSFILAGLACAFAAISYAELASIFPIAGSTYNYTYIAMGEFIAWIIGWDLILEYV
FALPAIALGWSGYFTNLLASVGINIPAWAANSAWQAPGGLINLPAIGILLVIAILNYIGV
RETATVNNIGVAFKVFVILFFIFVAVWHVKPSNWQPFMPYGWQGIFHGAAIIFFAYIGFD
AVSTAAEETKNPAKDMPIGILGSLGISTLLYIAVSAILTGVVSYTELNDPAPVAKALNLI
GLNWARGLVSLGAITGITTVLLVMFYGSTRIIFAMSRDGLLPPAFSKVHPKFRTPTLAIY
LITIATTLVAGFLPIGIIAELVNIGTMLAFILTSIGVIVLRYTQPDLPRKFRAPGVPWTP
LLAILFVLSLMLSLP
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaatcaaatctatttagaaagaaaactttagagatggtattgtcagaaacggaa
gctgctgaatacaaattgaagaaaactttaactgcaattgacttaatcgcattaggattg
ggcgcaatcataggtactggtatatttgttattactggtgttgccgccgctgaaaaagct
ggtcccgcaattgtgctctcttttattttagcaggattggcttgtgcttttgcagcaatt
tcttacgcagaattggcatcaatattcccaattgcaggttctacttataactacacttat
attgcaatgggagaatttatagcttggataataggatgggacttaatacttgagtacgtc
tttgctcttccagcaattgctttaggttggtctggttatttcactaacctcctggcaagt
gtgggaataaatattcctgcttgggcagctaactctgcatggcaagcacccggaggactt
attaatcttccagcaataggaatccttcttgtcattgcaatcttaaactacattggagta
agagaaactgctactgttaacaacattggcgttgcctttaaagtgtttgtaattctcttc
tttatctttgtcgctgtatggcatgtaaaaccatctaattggcaaccctttatgccttat
ggatggcaaggaatattccatggcgcagcaattatcttctttgcatatataggttttgat
gctgtttccacagctgctgaagagacaaagaatccagcaaaagatatgcctattggaatt
ttaggatctcttggaatcagtacccttttgtacatcgctgtttcagcaattttgacaggt
gttgtttcatacactgagttgaacgacccagctcctgttgcaaaagctcttaacttgata
ggtctaaactgggcaagaggacttgtatctttgggcgctataacaggtattacaacagtg
ttactcgttatgttctacggatctacaagaataatctttgctatgtctcgtgatggatta
cttccacccgctttttcaaaagttcatccaaaatttagaacacctactctggctatatat
ctcataacgattgcaacaactttagtggcaggattcttaccaattggcataatcgcagaa
cttgtaaatataggaactatgttagcttttatactcacttctatcggtgtaatagtatta
agatatacacaaccagacttaccaagaaaattcagagcacctggtgtaccatggacacct
cttttggcaattcttttcgtactttcactcatgctatctctgccatga

DBGET integrated database retrieval system