KEGG   Thioalkalivibrio sp. K90mix: TK90_0129Help
Entry
TK90_0129         CDS       T01174                                 

Definition
(GenBank) phosphoribosyl-ATP diphosphatase
  KO
K01523  phosphoribosyl-ATP pyrophosphohydrolase [EC:3.6.1.31]
Organism
tkm  Thioalkalivibrio sp. K90mix
Pathway
tkm00340  Histidine metabolism
tkm01100  Metabolic pathways
tkm01110  Biosynthesis of secondary metabolites
tkm01230  Biosynthesis of amino acids
Module
tkm_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:tkm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    TK90_0129
Enzymes [BR:tkm01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     TK90_0129
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-PH MazG Usp DUF1890
Motif
Other DBs
NCBI-ProteinID: ADC70645
UniProt: D3SCC6
LinkDB All DBs
Position
133216..133593
Genome map
AA seq 125 aa AA seqDB search
MAGRASDARAGAELLSALAEVIEQRRQADPEQSYVAKLHARGLDEMLKKLGEESAETIIA
GKNDDSDALVSEMADLWFHSLIVLAARGRHPDDVLDELARRFGLSGIAEKAARRASGQRS
DKNDK
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atggccgggcgtgcgtcagatgcccgggcgggtgccgaactcctgagcgcgctggccgag
gtgatcgaacagcggcgccaggccgacccggagcagtcctacgtggcgaagctgcacgcc
cgggggctcgacgaaatgctgaagaagctcggcgaggagtcggcggagaccattatcgcc
ggcaagaacgacgacagcgacgcgctggtgtcggagatggcggacctgtggtttcatagc
ctgattgtgctcgcggcccggggccgccaccccgacgacgtcctcgacgagctggctcgg
cgcttcgggttgtccggtatcgcggaaaaggccgcgcgccgggccagtgggcagcgctct
gataaaaacgataaataa

DBGET integrated database retrieval system