KEGG   Thioalkalivibrio sp. K90mix: TK90_1297Help
Entry
TK90_1297         CDS       T01174                                 

Definition
(GenBank) penicillin-binding protein 1B
  KO
K05365  penicillin-binding protein 1B [EC:2.4.1.129 3.4.16.4]
Organism
tkm  Thioalkalivibrio sp. K90mix
Pathway
tkm00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:tkm00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    TK90_1297
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:tkm01003]
    TK90_1297
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:tkm01011]
    TK90_1297
Enzymes [BR:tkm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     TK90_1297
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     TK90_1297
Glycosyltransferases [BR:tkm01003]
 Polysaccharide
  Bacterial polysaccharide
   TK90_1297
Peptidoglycan biosynthesis and degradation proteins [BR:tkm01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   TK90_1297
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase UB2H Beta-lactamase2 UvrB_inter
Motif
Other DBs
NCBI-ProteinID: ADC71805
UniProt: D3S9V0
LinkDB All DBs
Position
complement(1373043..1375385)
Genome map
AA seq 780 aa AA seqDB search
MPRKRMTRSRRGARSGGLRHFFGAGVWLFAGLALAGIGVGAIYVVSLDQEIRERFEGQRW
ALPARVYARPLELYEGRALTPQALETELETLNYRSSAQGSGPGEYRVDGNRVSFTTRPFT
FGDGPEPAHSVRVDFSDGRVQSVQKQGNGERVDLMRVEPLLIGSIYPTHGQDRILVAIDE
VPRELIGALLAIEDRRFMSHRGVDPAGIARAAMANLRAGRTVQGGSTLTQQLVKNFYLTR
DQTLARKANEAVMALLLERRYSKREILEAYINEVYLGQSGERAIHGFGQASQFYYQRPLN
ELRLDQLALLVGLARGASYYDPRRHPQRAKARRDQVLRAMLETGLADADQIEAALDTELD
VSPVVPQGRSRFPAFLDMVRRELRADYADEDLRSEGLRIFTTMDPVVQLTLEERLKAGVD
RVIEQRGSNLERLQAAAVVTDPQAGEVLAVVGDRNPQYPGYNRAVEAQRQVGSVLKPFVY
LAALTQPGRYTLASLLDDSPMTIQLPHGEPWTPRNFDREHRGDVTAWEALVQSYNVATVQ
LAQEIGISQLIDVLQTLGLQRTPAPLPSLALGAIELSPLEVAGLYQALANGGYATGTRAI
RDVLDLEDEVLSHYGLELRGAVPDGAVSLLTHALHDVTTEGTGRQISQRLPGRVVAGKTG
TTNNFRDSWFAGFDDRHVTVVWLGMDDNEATGLTGGVAAAPIWADVMAGLGAQSLQLGRH
PEIAYQEIDLKSGLRVEQDDHACEAVKTLPFWQNSIPESRADCDTGRTPDERGFFERLFR
NT seq 2343 nt NT seq  +upstreamnt  +downstreamnt
atgccccgaaaacgtatgacccgttcccgccgaggtgcccgatccggaggcctgcgccat
ttctttggtgccggggtgtggctgttcgccggtctggcgctggccggtatcggggttggg
gcgatctatgtcgtctcgctcgatcaggagattcgcgagcgcttcgagggccagcgctgg
gccttgccggcgcgcgtctacgcgcgaccgctggagctgtacgagggccgggcacttacg
ccccaggcgctggaaaccgaactggagacactgaactaccgcagtagtgcacagggaagc
ggcccgggcgagtatcgcgtggacggcaaccgggtgtcgtttaccacgcgcccgttcacc
tttggcgacggtccggagccggcccattcggtgcgagtggatttttcggatggaagggtg
cagtccgtccagaagcaagggaacggtgagcgcgtcgatctgatgcgggtcgagcccttg
ctgatcgggagcatctacccgacccatggccaggatcgcatcctcgtggccatagacgag
gtgccgcgggagctgatcggcgcgctgcttgcgatcgaggatcgtcgcttcatgtcgcac
cgcggggtagacccggcgggtattgcccgggcggccatggcgaacctgcgcgcggggcgg
acggtgcagggtggcagtacgctgacgcagcagctggtcaaaaacttctacctgacacgg
gaccagacgctggcgcgcaaggcgaacgaggcggtcatggccttgttgctggagcggcgc
tactccaagcgggaaatcctcgaggcctatatcaacgaggtctacctgggtcagtcgggc
gagcgcgcgatccacggattcggccaggcctctcagttctactaccagcggcccctgaac
gagctgcgcctggaccagctggcgctgctggtgggactcgcccgcggtgcgagctactac
gatccgcgtcgtcacccccagcgtgccaaggcgcgccgtgatcaggtgttgcgcgcgatg
ctggagaccgggttggccgatgccgaccagatagaggccgcactggataccgaactcgat
gtgtctcccgtggtgccgcagggccgcagccgattcccggcgttcctcgacatggtgcgt
cgcgagttgcgcgccgactacgcggacgaggacctgcgcagcgagggtctgcgcatattc
accaccatggacccggtcgtgcagctcacgctggaggagcgcctgaaggcgggggtggat
cgggtgattgagcagcgcgggtccaacctggagcggctacaggcggcggccgtcgtgacc
gacccgcaggcgggagaggtccttgcggtggtgggggatcgcaatccgcagtatcccggc
tataaccgggcggtcgaggcgcagcggcaggtcgggtcggtgctcaagcccttcgtctac
ctggcggcgctcacgcaacctgggcgctatacgctggcgagcctgctcgatgacagccca
atgaccatccagctgccgcatggcgagccctggacgccgcgcaatttcgaccgcgaacac
cgcggcgacgtaacggcctgggaggcgctggtccagtcgtacaacgtcgccacggtccag
ctggcacaagagatcggtatttcgcagctgatcgacgtattgcagacgctcggtttgcag
cgcaccccggccccgttgccctcgctggcccttggggcgatcgagttgtcgccactggag
gtggccgggctttaccaggcgctcgccaatggcggctatgcgaccggcacccgtgccatt
cgcgatgtcctcgacctggaggacgaggttctgtcccactacgggctggaactgcgcggt
gccgtacccgatggcgcggtcagcctgctgactcacgccctgcatgatgtgaccaccgag
gggaccgggcggcagatcagccagcgcctcccggggcgtgtcgtggccggcaagaccggc
accacgaacaacttccgcgatagctggttcgccgggttcgatgatcgccacgtcacggtc
gtctggctggggatggacgacaacgaggcgaccggcctgaccggaggtgtggctgcggct
cccatctgggccgatgtgatggccggtcttggcgcacagtcgctgcagctaggccgtcat
cccgagattgcctatcaggagattgacctgaagtccggcctccgcgtcgagcaggacgat
catgcctgcgaggcggtgaaaacgctcccgttctggcagaattccatccccgagagccgt
gccgactgcgacacgggccgtaccccggatgagcggggcttttttgagagattgttccgc
taa

DBGET integrated database retrieval system