KEGG   Thioalkalivibrio sp. K90mix: TK90_1908Help
Entry
TK90_1908         CDS       T01174                                 

Definition
(GenBank) ATP dependent DNA ligase
  KO
K07468  putative ATP-dependent DNA ligase [EC:6.5.1.1]
Organism
tkm  Thioalkalivibrio sp. K90mix
Brite
Enzymes [BR:tkm01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     TK90_1908
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNA_ligase DNA_ligase_A_M
Motif
Other DBs
NCBI-ProteinID: ADC72399
UniProt: D3SBJ4
LinkDB All DBs
Position
2024778..2025878
Genome map
AA seq 366 aa AA seqDB search
MIERHVLQEAIDNRRAEALTFDELEYARLLEPVNHYPRGSVVLPDGSVVPGYPSIGRIQS
LEAGLPRQFEQPFWAEEKIDGFNVRILRWQGRVYAFSRGGYVCAFSTDRVVDFMDPVIFN
AEPNLILCAEIAGPDTPYLEGSTPRVAHDVGLFVFDLMRLGQPGFVSQPEKFALIERHAL
PPAPLHGWFTPRDTRALGELIRRLDEEGAEGLVLKTADGQHRAKYVTGSSCVSDIRVCAE
QLLDLPPEYFTNRLTRLAIFLSEHPDRHHADLDQALGQALLSGLHGAVAQHRRQGHVGHR
YRCRFREHASALRFMNHMRATGGRHVSFAQDAPRQEDGYWLLEFERQFDRITGTLASALA
GDRQYD
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgatcgagcgccacgtgttacaggaagccatcgacaaccgtcgcgccgaggccctgacc
tttgacgagctggaatacgcccggctactggagccggtgaaccactacccgcgcggttcc
gtggtgctgccggatggctcggtggtgcccggatacccgtcgatcgggcgtatccagtcg
ctggaggccggactgccaaggcagttcgagcagccgttctgggcggaggagaagatcgac
ggcttcaacgtacgtatcctgcgctggcagggacgcgtctatgcgttcagccgcggcggt
tacgtctgcgcgttcagtactgaccgggtcgtggacttcatggacccggtcattttcaat
gccgaacccaatctgattctgtgcgcggagatcgccgggccggatacgccgtacctggaa
gggtccacgccccgggtcgcccatgacgtgggcttgttcgtattcgatctaatgcgcctg
ggacagcccggcttcgtgtcccagccagagaagttcgcgctgatcgagcgccacgccctg
cccccggcgcccctgcacgggtggttcaccccgcgcgacacccgcgccctcggcgagctg
atccggcgactggacgaggaaggcgccgagggactggtgctgaagaccgcggacgggcag
caccgggccaagtatgtgaccgggagctcctgcgtctccgatatccgggtctgcgcggaa
cagctactggacctgccaccggagtatttcaccaaccgcctgacacggctcgcgatcttc
ctgtccgagcacccggatcgacaccatgccgacctcgatcaggccctgggccaggcgctg
ctgtcagggctccatggcgcggtcgcacaacaccgccggcaggggcatgtcggccatcgc
tatcgctgccgctttcgcgagcatgccagcgcactgcgtttcatgaaccacatgcgcgcc
accggtgggcgccacgtcagctttgcacaggacgcgccgcgccaggaagatggctactgg
ctgctggagttcgagcgccagttcgaccgcatcacgggcacactggcctccgccctggcc
ggcgaccgccagtacgactga

DBGET integrated database retrieval system