KEGG   Thermococcus kodakarensis: TK0916Help
Entry
TK0916            CDS       T00226                                 

Definition
(GenBank) threonine 3-dehydrogenase
  KO
K00060  threonine 3-dehydrogenase [EC:1.1.1.103]
Organism
tko  Thermococcus kodakarensis
Pathway
tko00260  Glycine, serine and threonine metabolism
tko01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tko00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TK0916
Enzymes [BR:tko01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.103  L-threonine 3-dehydrogenase
     TK0916
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 ADH_N_2
Motif
Other DBs
NCBI-ProteinID: BAD85105
UniProt: Q5JI69
LinkDB All DBs
Structure
PDB: 

Position
798483..799535
Genome map
AA seq 350 aa AA seqDB search
MAEKMQAIMKTKPAYGAELVEVDVPKPGPGEVLIKVLATSICGTDLHIYEWNEWAQSRIK
PPQIMGHEVAGEVVEVGPGVEDLQVGDYISVETHIVCGKCYACKHNRYHVCQNTKIFGVD
MDGVFAHYAIVPAKNAWKNPKDMPPEYAALQEPLGNAVDTVLAGPIAGRSTLITGAGPLG
LLGIAVAKASGAYPVIVSEPSEFRRKLAKKVGADYVVNPFEEDPVKFVMDITDGAGVEVF
LEFSGAPKALEQGLKAVTPGGRVSLLGLFPREVTIDFNNLIIFKALEVHGITGRHLWETW
YTVSSLIQSGKLNLDPIITHKYKGFDKFEEAFELMRAGKTGKVVFFPHKG
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atggccgagaaaatgcaggctattatgaagactaagccggcgtacggcgccgaacttgta
gaagttgacgttccaaagcctgggccaggagaagtcctcattaaggttctcgcaacgagc
atctgcggtacagacctccatatctacgagtggaacgaatgggcgcagagcaggataaag
ccgccccagataatgggccacgaagtggctggagaggtcgtcgaggtcggtcccggcgtt
gaggatctccaggttggagattacatcagcgttgaaactcatatcgtctgtggcaagtgc
tacgcgtgcaagcacaaccgctatcacgtctgccagaacaccaagatattcggagttgat
atggacggtgtcttcgcccactacgcgatagttccggccaagaacgcctggaagaacccg
aaggacatgccgccagagtacgcagcccttcaggagccgctcggaaacgccgtcgatacc
gttcttgcaggcccgattgctgggaggagcaccctcataaccggtgctggaccgctcggt
cttctcggcatagcagttgccaaggcaagcggggcttatccagtcatcgttagcgagccg
agtgagttcagaaggaagctcgccaagaaggtcggtgctgactacgtcgttaaccccttc
gaggaagacccagtcaagttcgttatggacataaccgacggagcgggcgttgaagttttc
cttgagttcagtggtgcacctaaagcccttgagcagggcctcaaggcagtaacacccgga
ggacgcgtctcacttctcggcctcttcccgagagaggtcacgatagacttcaacaacctc
ataatcttcaaggcccttgaagtccacggcataaccggaaggcacctctgggaaacctgg
tacaccgtctcaagcctcatccagagcggcaagctgaacctcgatccgataatcacccac
aagtacaagggcttcgacaagttcgaggaagcctttgagcttatgcgcgctggaaagacc
ggaaaggtcgtcttcttccctcacaagggatga

DBGET integrated database retrieval system