KEGG   Thermococcus kodakarensis: TK1406Help
Entry
TK1406            CDS       T00226                                 

Definition
(GenBank) maltodextrin phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
tko  Thermococcus kodakarensis
Pathway
tko00500  Starch and sucrose metabolism
tko01100  Metabolic pathways
tko01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tko00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TK1406
Enzymes [BR:tko01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     TK1406
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphorylase DUF3417 Glyco_hydro_71
Motif
Other DBs
NCBI-ProteinID: BAD85595
UniProt: Q5JH18
LinkDB All DBs
Position
1230528..1233020
Genome map
AA seq 830 aa AA seqDB search
MVNVSNAVEDEIRKKLPYPLGDLADLAYNYWWSWNRRATKLWEYIDPEHWREYKNPVKLL
LDTPEERFKELVRDDDFMNLYELVMDQFHAYMNPRSTWFSTNYPKWDKPIVYLCMEYGIS
KSLPIYSGGLGILAGDHVKTASDLGLPFIAIGLLYKHGYFRQEIDKDGRQVEIFPEYKPE
EMPIKPVLDREGKPLRIEVPIGEGIVYARAFEVNVGRVKLYLLDTDVPENSPDDRTICDY
LYNAEMDKRIKQEILLGIGGMRLLKALEIEPGVIHLNEGHPAFANLQRIAWYMEEGLTFT
EALSIVRGTTVFTTHTPVPAGHDRFPIEEVKKRLAKFLEGREELLELGREGDQLNMTLLA
IRTSSYVNGVSQLHAEVSKRMWKDLWPGVPLNEIPIEGITNGVHTMTWVHNEMRKLFDRY
IGKVWREHTNLEGIWYAVERIPDEELWEAHLQAKREFIDLLRRKAIERNKRLGVDDPIPN
IDENALIIGFARRFATYKRATLLLTDLERLKKIVNNPERPVYIVFGGKAHPRDDGGKEFL
RRVYEVSKMPEFRGKIFVMENYDMGSARLMVAGVDVWLNNPRRPMEASGTSGMKAGLNGV
LNVSIYDGWWVEGYNGKNGWVIGEETTEPETEADDPKDAESLYTLLEEEVIPTYYENRAK
WIYMMKESIKSIAPRFSTHRMVKEYMDRFYSKAMSNYIWLTRENYSGAKEIAAWKDRVRA
SWDKVEIRDAKAEGNRLEVRVYLDGLKPEDVEVELYYGVRAQGYEIEKPHIVELRHPEQV
GEGEWLYTYEGNALRHLGDPCWHYAVRVHPHHEKLPHRFLLGLVKWKGLD
NT seq 2493 nt NT seq  +upstreamnt  +downstreamnt
atggtgaacgtttccaatgccgttgaggatgaaataaggaagaagctcccgtatccgctt
ggagacctcgccgatctggcctacaactactggtggagctggaacaggagggccacgaag
ctctgggagtacattgaccctgagcactggagggagtacaagaacccagtaaagctgctc
ctcgacactccagaggagcggtttaaggagctcgtccgcgacgacgacttcatgaacctc
tacgagctggtgatggatcaattccacgcctatatgaacccgcgctcgacctggttctcc
accaactaccccaagtgggacaagcccatagtctatctctgtatggagtacggcataagc
aagagcctgccaatttattctggcggtcttggaatcctcgccggagaccacgtgaagacc
gcgagcgaccttggacttcccttcatagccataggcctcctctacaagcacggctacttc
aggcaggagatcgacaaagacggcaggcaggttgagatattccccgagtacaagcccgag
gagatgccgataaagcccgtcctcgacagggaaggaaagccgctccgcattgaggttccg
attggggaggggattgtctatgcaagggcctttgaggtaaacgtcggcagggtgaagctc
tacctcctcgacaccgacgtcccagagaacagccccgacgacaggacgatctgcgactac
ctctacaacgccgagatggacaagaggataaagcaggaaatcctccttggaatcggcggg
atgaggcttctcaaggcccttgaaatcgagcctggggtcattcacctcaacgaggggcac
ccagcctttgcgaacctccagaggatagcctggtacatggaagagggtctgaccttcacc
gaggccctgagcatcgtgaggggaacgacagtctttacaacccacacgccggttccagca
ggccacgacaggttcccgatcgaagaagtcaagaagagactcgcaaagttccttgaagga
agagaggaactccttgaactcggaagagagggagatcagctcaacatgacccttcttgcc
ataagaacatccagctacgttaacggcgtcagccagctccacgctgaggtaagcaagagg
atgtggaaggatctctggccgggcgttccgctcaacgagataccgatagaaggaatcacg
aacggcgtccacaccatgacatgggtgcacaacgagatgagaaagctctttgacaggtac
atcggcaaggtctggagggaacacacgaaccttgagggcatctggtacgccgtcgagagg
attcctgacgaggaactgtgggaagcccacctccaggcaaagagggagtttatagacctc
ctgagaaggaaggccatagagagaaacaagaggctcggggtagacgaccccataccaaac
atagacgagaacgccctcataataggattcgcgaggaggttcgcgacctacaagcgcgct
acacttctcctcacggacctcgagaggctgaagaagattgtgaacaacccggagaggccc
gtttacatagtcttcggcggcaaggcccacccgagggacgatggaggaaaggagttcctc
aggagagtatacgaggtctccaagatgcccgagttcaggggtaagatattcgtgatggag
aactacgacatgggcagcgcgaggctcatggtggcaggcgtcgatgtctggctcaacaac
ccgcgcaggcctatggaagccagcgggacgagcggaatgaaggccgggctgaacggcgtt
ctgaacgtcagcatctacgacggctggtgggtcgagggctacaacggaaagaacggctgg
gtcattggagaagaaactaccgaacctgaaacggaagcggacgacccgaaggacgctgag
agcctctacaccctgcttgaggaggaagtcataccaacctactacgagaacagggcaaag
tggatatacatgatgaaggagagcataaagagcatagccccgcgcttcagcacccacagg
atggtcaaggagtacatggacaggttctattccaaggccatgagcaactacatctggctc
acaagggaaaactacagcggcgcaaaggagatagcggcgtggaaggacagggttagggcc
tcgtgggacaaagtggagataagggacgccaaggccgagggcaacaggcttgaggtaagg
gtttacctcgatggtctcaagccggaggacgttgaggttgagctctactacggcgtcagg
gcgcagggctacgagattgaaaagccccacatcgttgagctcagacacccagagcaggtg
ggagagggtgaatggctatacacctacgaaggaaacgccctcagacacctgggagacccg
tgctggcactacgcggtcagggttcacccgcaccatgaaaagcttccgcacaggttcctg
ttgggtctggtcaagtggaagggacttgactga

DBGET integrated database retrieval system