KEGG   Thermococcus kodakarensis: TK2290Help
Entry
TK2290            CDS       T00226                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase/oxygenase, typeIII
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
tko  Thermococcus kodakarensis
Pathway
tko00630  Glyoxylate and dicarboxylate metabolism
tko01100  Metabolic pathways
tko01120  Microbial metabolism in diverse environments
tko01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tko00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    TK2290
Enzymes [BR:tko01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     TK2290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: BAD86479
UniProt: O93627
LinkDB All DBs
Structure
PDB: 

Position
2073450..2074784
Genome map
AA seq 444 aa AA seqDB search
MVEKFDTIYDYYVDKGYEPSKKRDIIAVFRVTPAEGYTIEQAAGAVAAESSTGTWTTLYP
WYEQERWADLSAKAYDFHDMGDGSWIVRIAYPFHAFEEANLPGLLASIAGNIFGMKRVKG
LRLEDLYFPEKLIREFDGPAFGIEGVRKMLEIKDRPIYGVVPKPKVGYSPEEFEKLAYDL
LSNGADYMKDDENLTSPWYNRFEERAEIMAKIIDKVENETGEKKTWFANITADLLEMEQR
LEVLADLGLKHAMVDVVITGWGALRYIRDLAADYGLAIHGHRAMHAAFTRNPYHGISMFV
LAKLYRLIGIDQLHVGTAGAGKLEGGKWDVIQNARILRESHYKPDENDVFHLEQKFYSIK
AAFPTSSGGLHPGNIQPVIEALGTDIVLQLGGGTLGHPDGPAAGARAVRQAIDAIMQGIP
LDEYAKTHKELARALEKWGHVTPV
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggttgagaagtttgatacgatatacgactactatgttgacaagggctacgagcccagc
aagaagagggacatcatagctgtattccgtgtgacgccggcagagggctacactatcgag
caggcggctggagccgtggcagctgagagctcaactggaacctggacgacactctatccc
tggtacgagcaggagagatgggccgacctctcggccaaggcctacgacttccacgacatg
ggcgacggcagctggatagtcagaatagcctacccgttccacgcctttgaggaggccaac
cttccgggccttctcgcgagcatagccggaaacattttcggaatgaagcgcgtaaagggg
ctccgccttgaggatctttacttcccggagaagctcataagggagttcgacggcccggcc
ttcggtatcgagggcgtaaggaagatgctcgagattaaggacaggcctatctatggtgtc
gttccaaagccaaaggtcggttattctccggaggagttcgagaagctggcctacgacctt
ctctcaaacggtgccgactacatgaaggacgacgagaacctcacgagcccgtggtacaac
cgcttcgaggagagggccgagataatggcgaagataattgacaaggtagagaacgagacg
ggtgagaagaagacatggttcgcgaacataaccgctgacctcctcgaaatggagcagagg
cttgaggttcttgctgaccttggtctcaagcatgcgatggttgatgttgttataaccggc
tggggagcgctaaggtacatcagggacctcgcggccgattacgggcttgccatccacggc
cacagggcaatgcacgcggccttcacgaggaacccgtaccacggcatctcgatgttcgtt
cttgcgaagctttacaggctcataggcattgaccagctccacgttggaaccgctggagct
ggcaagcttgagggcggcaagtgggacgtcattcagaacgccaggattctcagggagagc
cactacaagcccgatgaaaacgacgtcttccaccttgagcagaagttctacagcataaag
gccgcgttcccgacaagctctggtggattacatccgggcaacatccagcccgttatagag
gccctcggaaccgacatagtcctccagctcggaggtggaaccctcggccatccggacggg
cctgccgcaggtgcacgggcagtcaggcaggcaatcgatgccataatgcagggaataccg
ctcgacgagtacgcgaagactcacaaggagcttgcgagggccctggagaagtggggtcac
gttactccagtctga

DBGET integrated database retrieval system