KEGG   Tetragenococcus koreensis: C7K43_00700Help
Entry
C7K43_00700       CDS       T05710                                 

Definition
(GenBank) DNA-binding response regulator
Organism
tkr  Tetragenococcus koreensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trans_reg_C Response_reg
Motif
Other DBs
NCBI-ProteinID: AYW44577
UniProt: A0A3G5F2N3
LinkDB All DBs
Position
132666..133391
Genome map
AA seq 241 aa AA seqDB search
MNILMIEDNESVCEMMQMFFLNEGWEVDFKYDGQAGIDGFLEDPQKWDMIILDLNLPEVD
GMVVARKIREVSSTVPLIMLTARDSESDQVIGLEIGADDYVTKPFSPLTLTARMKALHRR
SDLQSTASEDTNTQDNDTEFDVKTAHFQMNTKTREAYLMGKEINDLTPKEFDLLYTLANK
PRQVFSREKLLELVWDYQYFGDERTVDAHIKKLRQKIEKIGPQVIQTVWGVGYKFDDSGV
E
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgaacatattaatgattgaagataatgaatcggtttgtgaaatgatgcaaatgtttttt
ctaaatgaaggttgggaagttgattttaaatatgatggacaagcaggcatcgacggcttt
ttagaagatccgcaaaagtgggatatgatcatattggatctaaacttgcctgaagtggat
ggaatggtggtagctcgtaagattcgtgaagtttctagtacggtgccgttaattatgctg
acagctagagattctgaaagtgatcaggtaatcggcttagaaattggcgcagatgattat
gtaacgaagccctttagcccgttaaccttaactgcaaggatgaaagctcttcatcgacgt
agtgatttgcaaagtacggcttctgaagatacgaatacgcaagataatgacacagaattt
gatgtgaaaacagcgcattttcaaatgaatacgaaaacgcgagaagcttatttgatggga
aaagagatcaacgatttaacgcctaaagagtttgatttgctttatacgttagctaataag
ccacgacaagtgttttcacgcgaaaaattgcttgaattggtatgggattatcaatatttt
ggtgacgagcgaacggtagatgcacatattaaaaagttacggcaaaagattgaaaagatc
ggacctcaagtcattcaaacggtgtggggcgtcggttataagtttgatgattcaggagtt
gaataa

DBGET integrated database retrieval system