KEGG   Tetragenococcus koreensis: C7K43_01560Help
Entry
C7K43_01560       CDS       T05710                                 

Definition
(GenBank) AP endonuclease
  KO
K01805  xylose isomerase [EC:5.3.1.5]
Organism
tkr  Tetragenococcus koreensis
Pathway
tkr00040  Pentose and glucuronate interconversions
tkr00051  Fructose and mannose metabolism
tkr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tkr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    C7K43_01560
   00051 Fructose and mannose metabolism
    C7K43_01560
Enzymes [BR:tkr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     C7K43_01560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: AYW44721
LinkDB All DBs
Position
304453..305379
Genome map
AA seq 308 aa AA seqDB search
MKLATRINSFLPKFNNDLGEIFKEFNHIGLSHVDLNYPEHVEDISAQNMKELLDKNDLKA
NGVALRFRNEFINGELGNADKEISEKAVQLTKDAADYCREIEGEVVTIWLGFDGFDYSFQ
INYEKVWQQIKNCMIEIADYAPDLKISIEYKPFQPRAYAFIDSLGIAMSMMNEIDRENVG
ITLDYCHMLMKHENPAYGASILGSRQKLFGVHLNDGYGLNDDGLMIGTSSLVKTFEFLYY
TKLHNYDQAIYFDTFPVIEDPVEECEANLKMITRINEKIDQIGLNKITSIIEKNSGVKAS
ELVLEILS
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgaaattggcaaccagaatcaattcttttttacctaagtttaataatgacttaggagaa
atttttaaagaatttaatcatattggtttaagtcatgtagatttaaattatccagaacat
gttgaagacatatcagcgcaaaatatgaaagagcttctagacaaaaatgatttaaaagca
aacggtgttgcgctacggtttcgcaatgaatttatcaatggagaactaggtaacgctgat
aaggaaatttcagaaaaagcagtccagcttactaaagatgccgcagattactgcagagaa
attgaaggggaagtcgttactatttggctaggcttcgatggctttgattattcatttcaa
attaattatgaaaaagtttggcaacaaattaaaaattgcatgatcgaaattgctgactat
gcgcctgatcttaaaattagtattgagtataaaccattccaacctcgcgcttatgctttt
attgatagtttaggaattgcgatgtcaatgatgaatgaaatcgatcgtgaaaatgtgggc
atcactttagactattgtcatatgttaatgaagcatgaaaaccccgcgtatggtgcaagt
attttaggaagtcgtcaaaaattatttggtgttcatttaaatgacggctatgggttgaac
gacgatggtctgatgattggtacaagtagtttggtaaaaacttttgaattcttatattac
acaaaactgcataattatgatcaagcgatttattttgatacttttccagtgatcgaagac
ccggtcgaagaatgtgaggccaatttaaaaatgatcactcggataaatgaaaaaattgat
caaatcggcttaaataaaataacatcaataatagaaaaaaatagtggtgtaaaagcaagt
gaacttgtattggaaatcttatcttaa

DBGET integrated database retrieval system