KEGG   Tetragenococcus koreensis: C7K43_08000Help
Entry
C7K43_08000       CDS       T05710                                 

Definition
(GenBank) ribose 5-phosphate isomerase A
  KO
K01807  ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
tkr  Tetragenococcus koreensis
Pathway
tkr00030  Pentose phosphate pathway
tkr01100  Metabolic pathways
tkr01110  Biosynthesis of secondary metabolites
tkr01120  Microbial metabolism in diverse environments
tkr01130  Biosynthesis of antibiotics
tkr01200  Carbon metabolism
tkr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tkr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    C7K43_08000
Enzymes [BR:tkr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     C7K43_08000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rib_5-P_isom_A DeoRC Sugar-bind CoA_trans AAA_30
Motif
Other DBs
NCBI-ProteinID: AYW45899
UniProt: A0A3G5F6G5
LinkDB All DBs
Position
1673672..1674346
Genome map
AA seq 224 aa AA seqDB search
MSLKEDVGIKAASYVKNGMTVGLGTGSTAYYMIKEIGRKVKEENLNVVGVPTSSTSKKQA
EEMGIPIKSIDEVDKVDVIIDGADEISADFQGMKGGGAALLFEKIVATYTDQVIWIVDES
KMVDKLGKFPLPVEVVPYGQQQLFQLFAKKGYKPSFRMDQKAKKVTDSGHSIIDLHLEQI
DHPEQLAKELDETVGVIDHGLFLNMVNTVIIGRPSGAEIISDIR
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
gtgagcttaaaagaagatgtgggaattaaagcagctagttatgtcaaaaacggaatgaca
gtaggacttggtaccggctcaaccgcttattatatgattaaagagattggtcgaaaagta
aaagaagaaaatcttaacgtggttggcgtccctacttcgtctacttcaaaaaaacaagca
gaagaaatgggtattcccattaaatcgatcgatgaagtcgacaaagtcgatgtcattatc
gatggcgccgacgaaatcagcgctgactttcaaggcatgaaaggtggcggcgccgcttta
ctatttgaaaagattgtcgcaacttatactgatcaagtgatctggatcgtcgatgaatca
aaaatggtggataaactaggcaagttccctctgcccgtcgaagttgttccttacggtcag
cagcaactatttcagttatttgccaaaaaaggatataaaccaagttttcgtatggaccaa
aaagcaaaaaaagtcactgatagcggacactcaattattgaccttcacttggaacaaatc
gatcatcccgaacaattagctaaggaattagatgaaacggtaggcgttatcgatcacggc
ttatttttgaatatggtcaacacagtgatcattggtagaccaagcggggctgaaattatt
tccgatattcgctag

DBGET integrated database retrieval system