KEGG   Thermovirga lienii: Tlie_0307Help
Entry
Tlie_0307         CDS       T01644                                 

Definition
(GenBank) Type II site-specific deoxyribonuclease
  KO
K01155  type II restriction enzyme [EC:3.1.21.4]
Organism
tli  Thermovirga lienii
Brite
KEGG Orthology (KO) [BR:tli00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic Defense System [BR:tli02048]
    Tlie_0307
Enzymes [BR:tli01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.4  type II site-specific deoxyribonuclease
     Tlie_0307
Prokaryotic defense system [BR:tli02048]
 Restriction and modification system (R-M system)
  Type II R-M system
   Restriction endonucleases
    Tlie_0307
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DpnII Peptidase_M99_C
Motif
Other DBs
NCBI-ProteinID: AER66046
UniProt: G7V6T7
LinkDB All DBs
Position
326341..327243
Genome map
AA seq 300 aa AA seqDB search
MKKICEIAELSEDEFFSYFIKNLKVKITKWDYFVNWEKVIKNVKPIERELNLLNCLIGKE
DFIREASELILEYPQVIKAIPKLLAIRENSIEILVDVTKFIYKAFDFTINKPNREKATDF
ARFLLDSGIGKFLKDREIKNLVDYVTGVEVGLDSNARKNRTGSLMESIVEVFVADACAVN
NADYISQATASKIKNKWGINIQIDKSSRQIDFAINKNNKLYFIETNFYGGGGSKLKSTAG
EYITMNQFWNKQGIEFLWITDGQGWVSTQLPLREYFNQADYLLNLDMLQKGYLNKILKKF
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatatgtgaaattgcggaattgtctgaggatgagttcttcagctattttata
aaaaatttgaaagttaaaattaccaaatgggactattttgttaattgggaaaaagttata
aaaaatgtaaagcctattgaaagagaattgaatcttttgaattgtctgataggaaaagaa
gattttattagagaagcctctgaactcattttagagtatccacaagtaataaaagcaatt
cccaaacttttagcaattagggaaaattcaatagagattttggttgacgtaactaaattc
atatacaaagcttttgattttaccattaataaaccaaacagagaaaaagctactgacttt
gcaaggttcttattagattctggaataggaaaatttttaaaagatcgagaaatcaaaaat
ttggtagattatgtaactggtgttgaggtaggtttagacagtaatgcaagaaaaaatcgc
acaggcagtttaatggaatcaattgttgaggtttttgtggccgatgcatgtgcagttaat
aatgcagattatattagtcaagcaactgcatctaaaataaaaaacaagtggggaataaat
attcaaatagacaaatcgtcaagacaaattgattttgctattaataaaaacaacaaactt
tactttattgaaacaaatttttatgggggtggtggctcaaaactaaaatccactgctggt
gaatatattacaatgaatcagttttggaataaacaggggatagaatttctatggattact
gacggacaaggatgggtaagtacacaacttcctttaagagaatattttaatcaggctgat
tacctgttgaatttggacatgctacaaaagggatatttaaataaaatattgaaaaaattc
taa

DBGET integrated database retrieval system