KEGG   Thermovirga lienii: Tlie_1116Help
Entry
Tlie_1116         CDS       T01644                                 

Definition
(GenBank) pyruvate flavodoxin/ferredoxin oxidoreductase domain protein
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
tli  Thermovirga lienii
Pathway
tli00010  Glycolysis / Gluconeogenesis
tli00020  Citrate cycle (TCA cycle)
tli00620  Pyruvate metabolism
tli00640  Propanoate metabolism
tli00650  Butanoate metabolism
tli00680  Methane metabolism
tli01100  Metabolic pathways
tli01110  Biosynthesis of secondary metabolites
tli01120  Microbial metabolism in diverse environments
tli01130  Biosynthesis of antibiotics
tli01200  Carbon metabolism
Module
tli_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tli00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tlie_1116
   00020 Citrate cycle (TCA cycle)
    Tlie_1116
   00620 Pyruvate metabolism
    Tlie_1116
   00640 Propanoate metabolism
    Tlie_1116
   00650 Butanoate metabolism
    Tlie_1116
  09102 Energy metabolism
   00680 Methane metabolism
    Tlie_1116
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Tlie_1116
Enzymes [BR:tli01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Tlie_1116
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C Robl_LC7
Motif
Other DBs
NCBI-ProteinID: AER66849
UniProt: G7V566
LinkDB All DBs
Position
1174814..1175980
Genome map
AA seq 388 aa AA seqDB search
MARKDITSGNWAAAEAMRQINPDVVAAYPITPSTDIPMKFSEFVADGLVDTNLVTVESEH
SAISACLAASISGARVMTASSANGVALMHEIFPIAASYRAPIVFALVNRSIGAPINIHCD
HSDSMAERDMGWIHLYCEDAQEVYDSLIMGVRIAEHKDVLLPVFVCQDGFITSHCFEPIE
FLEDEEVKNFIGERDPLFPLLDVDNPVAYGSLALTDYYFEIKRQQIEAMKNVRKVYEEVS
EEFFKLTGRKYPVIEAYKTEDAEYVAVIMSSATGAVKEAVDKLRAEGHKVGCLRVRMFRP
FPWQDIAETLKGKKGIAVLDRAVSIGAGAPLFTEVKGALYDSGTLVPTNSYVYGLGGRDF
FVHDAEKAFMDMINGDFSPEERYLGLRE
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atggcacgtaaagatataacaagtggcaactgggctgcagcggaggccatgagacaaata
aaccccgatgtcgtagccgcttatccaattacaccatccacagatatacccatgaagttc
tctgagtttgtagctgatggcttggtggacaccaatcttgtaactgttgaaagtgaacac
tcagccataagcgcatgcttggcggcttccatttcaggcgcaagagtaatgaccgcatcc
agcgccaacggcgtagcactaatgcatgaaatattcccaattgctgcttcttatagagca
cctatagtctttgcattagtgaacagaagcattggggcccccataaacatccactgcgat
cacagcgacagtatggctgaaagagacatgggctggatacatctctactgcgaggatgcc
caggaagtttatgactcattgataatgggtgtaagaattgcagagcacaaagacgtactt
cttcccgttttcgtctgccaggatggattcataacaagccactgctttgagcccattgag
tttcttgaggatgaagaggttaaaaacttcatcggggaaagagatcctttgttcccattg
cttgacgtagacaaccctgtagcctacggttctttggccctgacagattattatttcgaa
atcaagcgccagcaaatcgaagcaatgaaaaacgtaagaaaggtatatgaagaagtatca
gaggagttcttcaaacttactggacggaaatacccggtcatagaagcatacaagacggaa
gacgcggagtatgtagcggtcataatgtcctccgcaacaggcgccgtaaaagaagctgtc
gacaaattgagggcagaaggccacaaggtggggtgcttgagggtcagaatgttcaggcct
ttcccgtggcaggatatagcagaaaccttaaaaggaaagaaaggcatagcagttttagac
cgggctgtgagcataggagctggcgcacctctgtttactgaagtaaaaggagccctgtac
gacagtggaacgctagttcccaccaacagctacgtttatggcctaggtggaagagatttc
ttcgtccatgatgccgaaaaggcgtttatggacatgatcaacggcgattttagcccagag
gaacgctacctcggactgagggaataa

DBGET integrated database retrieval system