KEGG   Thermococcus litoralis: OCC_02099Help
Entry
OCC_02099         CDS       T02800                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
tlt  Thermococcus litoralis
Pathway
tlt00620  Pyruvate metabolism
tlt00680  Methane metabolism
tlt00720  Carbon fixation pathways in prokaryotes
tlt01100  Metabolic pathways
tlt01120  Microbial metabolism in diverse environments
tlt01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tlt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    OCC_02099
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    OCC_02099
   00680 Methane metabolism
    OCC_02099
Enzymes [BR:tlt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     OCC_02099
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase_2 HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: EHR79821
UniProt: H3ZJQ8
LinkDB All DBs
Position
complement(1973572..1975002)
Genome map
AA seq 476 aa AA seqDB search
MIPRTMSTQHPDNVFIPFFAHDAALGGEDEVVEAFYAFSVLGVDEQMWDFEGKEVDEFVV
KKLLEKYGSFFRKRKLGKDFRITPRVPNPSVERAEAKLLLETLESIPRSADYAKLFYGEE
IAPIFEVILPMTTSSEEIERVYELYRRYIIGKQYKRVYDVKIYEWIGEFYPEEINIIPLF
ETKEAILNSHEILEEYLTGKNFEYQRVFLARSDPAMNYGLISAVMYDKYALFKLQELEEE
LSIPIYPIIGVGGVPFRGHFTPKNVDAAMEEYPSVQTFTVQSSFKYDNEPKEVIKAIEKV
NDTKRKETPAIDERIFEILDKYEEEYTKELKILAPYIREVAKAVPSRRKRKLHIGLFGYS
REVNGEALPRAIKFTASLYSLGIPPEILGLRALSEKELETISEHYRGLYNDISFALRFFN
PKAASHFKFLEDIAKMQKEMGIEKDERHLSITTQILNGKIEESLVVEAAGIRGFLG
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgataccaagaactatgagtactcaacatcccgacaatgtatttatacctttttttgct
catgacgctgcccttggaggagaggatgaagtggttgaagcgttctatgctttcagcgtt
cttggagtagacgagcagatgtgggatttcgaaggaaaggaggttgacgaattcgttgta
aagaaattactggaaaaatatggaagctttttcagaaaaagaaagcttggcaaggacttt
aggatcacaccccgtgtgccaaatccaagtgtggagagagcagaggcaaagcttttgctt
gaaacgcttgaaagtattcccagatccgccgactatgcaaagttattttacggagaggaa
atcgctccaatttttgaagttatattacccatgacaacttcttctgaagaaatcgaaagg
gtgtacgagctttacagaaggtatatcataggaaagcagtacaaaagggtgtacgacgtt
aaaatctacgagtggattggagaattttatccagaagagataaacataattcccttattc
gagacaaaagaggccattctgaactcccacgaaatcctggaggaatatctgaccggaaaa
aactttgagtaccagagggtatttttggccagaagcgaccctgcaatgaactatggtctc
ataagtgcggtaatgtatgacaaatatgctttattcaaactccaagaacttgaagaagaa
ctaagcatccccatatatccaataattggtgtcggtggagtcccttttaggggacatttc
acacccaagaatgttgatgcagcaatggaagaataccccagcgtccagacctttactgtc
caaagttcatttaaatatgataatgagcctaaagaagttatcaaagctattgaaaaggta
aacgatacaaaaagaaaagaaacgccagcaattgatgagaggatatttgagatactcgac
aaatatgaagaagaatacaccaaggaacttaagattctcgccccatatatacgagaggtt
gcaaaggctgttccctcaagaaggaaaaggaagcttcacatagggctctttgggtattca
agagaggtcaatggagaagcccttccgagggctataaagttcacggcatctctgtactct
ctcggaatacctccagaaatcctaggattaagagcgctaagtgaaaaggagctggagaca
ataagtgaacactacagggggctttataatgatatatcttttgcgttaagattttttaat
ccaaaagcggcttcccatttcaaatttttggaggatatagctaaaatgcaaaaagaaatg
ggcatagaaaaggatgaaaggcatctaagcataaccactcagatactgaatggaaaaatt
gaagagagccttgtggtagaggcggctggtatcagaggatttctcggctaa

DBGET integrated database retrieval system