KEGG   Thermococcus litoralis: OCC_08390Help
Entry
OCC_08390         CDS       T02800                                 

Definition
(GenBank) aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
tlt  Thermococcus litoralis
Pathway
tlt00030  Pentose phosphate pathway
tlt01100  Metabolic pathways
tlt01120  Microbial metabolism in diverse environments
tlt01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tlt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    OCC_08390
Enzymes [BR:tlt01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     OCC_08390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: EHR79492
UniProt: H3ZKR0
LinkDB All DBs
Position
complement(2081310..2083127)
Genome map
AA seq 605 aa AA seqDB search
MFGYMGKILRVNLTTGEIKVEELKEEDAKEFIGGRGLATKLLLEEIDPKVDPLSPENKLI
FATGPLTGTTAPTGGRYMVVTKSPLTGFIASSNSGGFFGPELKFAGYDALIVEGKADHPV
YISIKDEDVEIKDASHLWGKRVGETTDKLLEEFGDKKARVACIGPAGENLVRFANIMNDK
HRAAGRSGVGAVMGSKNLKAVVVRGTKQVELADKEKFMSVVKEKIKKIKENPITGGGLPQ
YGTAVLVNIINENGLYPTYNFQTGVFKYANEQSGEALAAKYLVRNHPCFACPIGCGRVSY
HPAVGITEGPEYESIWALGATCGINDLASIVIANHLCDEFGLDTISTGGTLAAAMELYEK
GIIKQEELGDAPPLRFGNSEVLHYYIEKIAKREGFGDKLAEGSYRLAESYGHPEYSMSVK
KQELPAYDPRGAEGHGVTYATSNRGGCHVRGYMISPEILGVPVKLDPHDVSEEKAKWVKI
FQDLTAVIDSAGLCLFTSFALGADDYAEMLNAATGFDYTTNEWLKAGERVWNIERIFNLK
AGLVPEKDDTLPKRFLEEPMPEGPNKGHVVKLHEILPKYYKLRGWDEKGYPTEEKLKELG
LDKYY
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgtttggatatatgggaaagatattgagagttaacctaacgacgggagaaataaaagtg
gaagaactgaaggaagaagacgcaaaggagttcattggtggtagaggtctcgcaacaaag
cttcttttggaggaaatagatccaaaagttgatccacttagcccggagaataagttaatc
tttgccacgggccccttgaccggaacaaccgccccaaccggcggtaggtacatggtagtt
acaaagtctccattaacaggcttcatagcctcaagtaattccggtggcttctttgggcca
gagctcaagtttgcaggttatgatgccttgattgttgagggaaaggcagaccatccagtt
tacattagcataaaggatgaagatgtggagatcaaagatgcctcccacctttggggtaag
agagttggagaaactactgacaagcttcttgaagagtttggagacaaaaaggctagggtt
gcttgtatagggcctgcgggagagaaccttgtaaggtttgcaaacataatgaacgataaa
cacagggcagctggaagaagcggtgttggagcagtaatgggaagcaagaacttaaaggct
gttgtcgttaggggaacaaagcaagtagagcttgctgacaaagaaaagttcatgagcgtc
gttaaggagaagataaagaagataaaggagaatccaattacgggcggaggacttccacag
tatggaactgcagttctagtaaacataatcaacgagaatggtctttatccaacgtacaac
ttccagacaggagtctttaagtacgccaatgagcagagcggtgaagctttggccgcgaag
tatttagtgaggaaccacccatgctttgcatgtccaattggatgtggaagagtctcatat
cacccagctgtaggaattaccgaaggtcccgaatacgagagcatatgggctcttggtgca
acctgtggcataaacgacttggcgagcatagtgatagcaaaccacctctgtgacgaattt
ggtcttgatacgatttcaacaggtggaactctagcggcagctatggagctttatgagaag
ggaatcataaagcaggaagagcttggagatgcaccaccattgaggtttggaaacagtgaa
gtgctccattactacattgagaaaattgcaaagagagagggctttggggacaaactagct
gaaggaagctaccgcttggctgagagctacgggcatccagagtactcaatgagcgttaag
aagcaggagctcccagcatacgatcccagaggagcagaaggacacggtgttacttatgcc
acctccaacagaggcggatgtcacgttagaggttacatgatcagtccagaaatcttaggt
gttccagtaaagcttgatcctcatgacgtaagcgaagagaaagccaagtgggttaagata
ttccaagatttgactgcagtaatcgattctgctggactgtgcctcttcacaagctttgca
cttggagcggatgactacgccgagatgctaaatgccgcaacgggctttgattacacaact
aacgagtggctcaaggcgggagagagagtatggaacattgagaggatctttaaccttaaa
gccggcttagtcccagaaaaagacgatactctacccaagagattcttagaagagccgatg
cctgaagggcccaacaaaggacacgtggtaaaactccacgagatccttccaaaatactac
aagctcagaggctgggacgagaaaggatatccgactgaggagaagcttaaggagcttggt
ttggataagtattattaa

DBGET integrated database retrieval system