KEGG   Thermococcus litoralis: OCC_08779Help
Entry
OCC_08779         CDS       T02800                                 

Definition
(GenBank) alpha-glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
tlt  Thermococcus litoralis
Pathway
tlt00500  Starch and sucrose metabolism
tlt01100  Metabolic pathways
tlt01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tlt00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    OCC_08779
Enzymes [BR:tlt01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     OCC_08779
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphorylase DUF3417 Glyco_hydro_71
Motif
Other DBs
NCBI-ProteinID: EHR79635
UniProt: Q9YGA7
LinkDB All DBs
Position
complement(1796405..1798900)
Genome map
AA seq 831 aa AA seqDB search
METVVNQIKSKLPENLEGLLDLAYNYWWSWNRRATKLWEKIDPEHWWEYKNPVKLLLDTP
EERLKELSKDDDFINLYELVIDQFRHYMNPESTWFSTNYPKWEEPVIYLCMEYGISKSLP
IYSGGLGILAGDHIKTASDLGIPLIAIGLLYKHGYFKQEIDKDGKQIEVFPEYNPEEMPI
KPLTTEKGKPLLIEVPIEDRIVYARAFEVNVGRVKLYLLDTDVPQNSPDDRTICDYLYNA
EIDKRIKQEILLGIGGMRLLRMLGIDPAVIHLNEGHPAFANFQRIAWYMEEGLNFLEALT
VVRGTTIFTTHTPVPAGHDKFPIAEVEKRLAKFLEGLPKDEFLNLGREGDQFNMTLLSIR
TSSYVNAVSKLHSKVTKEMWRHLWNGVPLDEIPVEGITNGVHTKTWLHNEIKKLVDRYIG
RVWRDYAELEGLWYGVERIPDEELWEAHLKAKREFIELIKRKIKERNERLGIEEPLPEID
ENALIIGFARRFATYKRATLILTDLERLKKIVNNPERPVYIIFGGKAHPRDEAGKEFLRK
VYEVSQMPEFKNKIMVFENYDMGSARAMVAGVDVWLNNPRRPLEASGTSGMKAGLNGVLN
LSVYDGWWVEGYNGKNGWVIGDESLEPETEKDNIRDAQSLYNLLENEVIPTYYENRARWI
YMMKESIKSIAPRFSTHRMVKEYVDKFYSKALANAILLQRDSFKATREIASWKAKIFNSW
DKVEIERIITHDATGVEVIVNLDGLSPEDVKVEIYYGVKAEGYAIEKPYVIELKHPQSLG
GNRWLYRYEGNALKNLGHPCWHYAVRVYPYHDKLPHKFLLGLIKWKGFFEL
NT seq 2496 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccgttgttaatcagataaaatcaaaactcccagaaaatttggaaggtcttttg
gatctagcctataactactggtggagctggaataggagagccacaaaactctgggaaaaa
atagatcccgaacactggtgggaatataaaaatccagtcaagcttctcctcgatactcca
gaggagagattaaaggagctttcaaaagatgatgattttataaacctctatgaactcgta
attgatcagttcaggcattacatgaatccagaaagcacgtggttttcaaccaattatcca
aaatgggaggaacccgtaatatatttgtgtatggaatacgggataagcaagagcctccca
atttattccggtggacttggaatacttgccggtgatcacataaagacggcaagcgatttg
ggaataccgcttatagctatcggtcttctttacaagcacggatatttcaaacaggaaatc
gacaaagatgggaaacagatagaggtgtttccagagtacaacccagaggaaatgccgatt
aagcccctaaccacggagaaaggaaagccactcctcatagaagtaccaatagaggataga
atagtgtatgcaagagcctttgaagtcaatgtcggtagggtaaagttgtatcttctcgat
accgatgttcctcaaaactctccggatgataggaccatctgtgactacctctacaacgct
gagatagacaagagaataaagcaggagatacttctagggattggtggaatgaggctttta
agaatgctgggaattgatccagctgttattcaccttaatgaaggacatccagcgtttgca
aacttccaaagaatagcatggtatatggaggagggtctaaactttttggaagctttaact
gtcgtaaggggcacaacgatttttacaacccacactcccgtgccagctggacatgacaaa
ttcccaatagcggaggttgagaaaagacttgccaaattccttgaaggccttccaaaggat
gaattccttaatttaggcagagagggagatcagtttaacatgacccttctctcaataaga
acctcgagctatgtaaacgctgtgagtaagctccattcaaaggtaactaaagaaatgtgg
agacacctctggaacggtgttcccttagacgagattccggtagagggcatcacaaacgga
gttcacacaaaaacatggcttcataacgagataaagaagctcgtcgataggtatattggg
agagtctggagagattatgcagagctcgagggtctctggtatggagtggagagaattcca
gatgaggaactctgggaagcccatttaaaggcaaaaagagagttcatagaactcatcaaa
aggaagataaaagagagaaacgagcgccttggaattgaagaacctctacccgaaatagat
gagaacgccttaataataggctttgcaaggcgtttcgcaacctataaacgggcgacgcta
attttaaccgatttggagaggctgaaaaagatagttaacaacccagaaagacccgtgtat
ataatttttggaggaaaagcccatccaagggatgaagcgggcaaggagttccttaggaag
gtctatgaagtatcccagatgcccgaatttaagaacaaaatcatggtgtttgagaactac
gatatgggctctgcaagggccatggtggcaggggtcgatgtgtggctcaacaatccaaga
agaccactagaagcaagcggaaccagtggaatgaaagcaggtttaaacggcgttttgaat
ttgagcgtctatgatggatggtgggtcgaaggttacaacggcaaaaacggatgggtcata
ggagatgaaagtctcgaaccggaaacagagaaagataacattagagacgctcagagcctc
tataaccttctcgaaaatgaagtaatccccacatactacgagaacagggcaagatggatt
tacatgatgaaggagagcataaagagcattgcaccaaggttcagcacccacagaatggta
aaagagtacgtcgacaagttctactcaaaagctctggcaaatgctatccttctccagaga
gacagctttaaagcaacaagggaaattgcatcgtggaaagcgaagatcttcaactcttgg
gataaggtagagatagagcgcattataacccatgatgccactggagttgaagttatagta
aacctcgacggcctaagcccagaggatgtaaaggttgaaatttattacggagtcaaagca
gaaggatacgcaatagaaaaaccctacgtcatagagcttaaacaccctcaaagtctcgga
ggcaacagatggctttatcgctatgaagggaacgcactcaaaaatctcggccatccttgc
tggcactatgccgttagagtttatccataccatgacaagcttccccacaagtttttactt
ggtcttatcaaatggaagggattttttgagctctga

DBGET integrated database retrieval system