KEGG   Thermotoga maritima MSB8: TM1394Help
Entry
TM1394            CDS       T00022                                 

Definition
(RefSeq) hypothetical protein
  KO
K04083  molecular chaperone Hsp33
Organism
tma  Thermotoga maritima MSB8
Brite
KEGG Orthology (KO) [BR:tma00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:tma03110]
    TM1394
Chaperones and folding catalysts [BR:tma03110]
 Heat shock proteins
  HSP33
   TM1394
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP33 DUF61
Motif
Other DBs
NCBI-GeneID: 898082
NCBI-ProteinID: NP_229195
UniProt: Q9X1B4 G4FFD0
LinkDB All DBs
Structure
PDB: 

Position
1408561..1409433
Genome map
AA seq 290 aa AA seqDB search
MIYYGTMFDHKVRFSIVRMREVVEEARNRHALSYLATVVLGRALIGAALVTPWLAEKERW
TLDIEGNGPIRRVVAQSTSEFTVRGYVANPKVELPLNEKGKFDVAGAIGQGVLRVVRDLG
LKTPFVSQVPLVSGEIAEDLAYYFAVSEQIPSAFSIGVLVDSDGVKIAGGFAVQIIDRTL
EQEKVEMIEKNIKNLPSISKLFQEAEPLDVLERIFGEKVGFVETAEIKYKCDCNREKAKN
ALLVLDKKELEDMRKEGKGEVVCKWCNTRYVFSEEELEELLKFKVDDSGS
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgatttactatggcacgatgttcgatcacaaggtgagattttcgatcgttcgaatgaga
gaagtggtggaagaggctcgaaacaggcacgccctttcatacctcgccacggtggtactc
ggaagagccctcatcggtgcggctcttgtaacaccatggctcgccgaaaaagaaaggtgg
acgctggacatagagggaaacgggccaataaggagagtcgttgcacagtcgaccagcgaa
ttcactgtcaggggatatgtggcaaatcccaaggtggaactgcccctaaatgaaaaggga
aagttcgatgtcgccggtgctatcggtcagggtgttctcagagtggtaagagatctggga
ttgaaaactccctttgtctctcaggtgcctctggtgagcggtgagatcgccgaagacctg
gcttattatttcgcggtttctgaacagataccatccgctttttccatcggtgttcttgtg
gactcagacggtgtgaagatcgcgggaggattcgccgtccaaatcatcgatcgcactctt
gaacaggagaaggtggagatgatagagaaaaacatcaaaaaccttcccagtatatcaaaa
cttttccaggaagcagaacctctggacgttctggaaagaatattcggtgagaaggtaggg
ttcgtcgaaacagcggaaataaagtacaaatgcgattgcaacagggaaaaagccaaaaac
gcccttctagtcctggacaaaaaagaattggaagatatgcgaaaagaagggaagggagaa
gtcgtctgtaagtggtgtaacacaagatacgttttctcagaggaggaattagaagaactc
ctcaagttcaaggtagatgactctggttcctga

DBGET integrated database retrieval system