KEGG   Tenacibaculum maritimum: MARIT_0973Help
Entry
MARIT_0973        CDS       T05240                                 

Gene name
tuf
Definition
(GenBank) Elongation factor Tu (EF-Tu)
  KO
K02358  elongation factor Tu
Organism
tmar  Tenacibaculum maritimum
Brite
Translation factors [BR:tmar03012]
 Eukaryotic Type
  Elongation factors
   MARIT_0973 (tuf)
 Prokaryotic Type
   MARIT_0973 (tuf)
Mitochondrial biogenesis [BR:tmar03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    MARIT_0973 (tuf)
Exosome [BR:tmar04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   MARIT_0973 (tuf)
  Exosomal proteins of breast cancer cells
   MARIT_0973 (tuf)
  Exosomal proteins of colorectal cancer cells
   MARIT_0973 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW
Motif
Other DBs
NCBI-ProteinID: SFZ81156
UniProt: A0A2H1E892
LinkDB All DBs
Position
1001965..1003152
Genome map
AA seq 395 aa AA seqDB search
MAKGTFDRSKPHLNIGTIGHVDHGKTTLTAAITKVLADAGLSEARDFDQIDNAPEEKERG
ITINTSHVEYQTANRHYAHVDCPGHADYVKNMVTGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGIPRIVVFLNKVDMVDDEELLELVDMEVRELLSFYDYDGDNGPVVSGSALGALN
GEQKWVDTVLELMEAVDNWIEEPLREVDKDFLMPIEDVFSITGRGTVATGRIETGIANTG
DSVDIIGMGAEKLTSTITGIEMFRQILDRGEAGDNAGILLRGINKEDIKRGMVICKPGSV
TPHAKFKAEVYILKKEEGGRHTPFHNNYRPQFYVRTTDVTGTINLPDGVEMVMPGDNLTI
TVDLIQPIALNVGLRFAIREGGRTVGAGQVTEMLD
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaggaacttttgaccgttcgaaaccacacttaaacattggtactatcggacac
gtagatcacggtaaaactactttaacagctgcaattactaaagtattagctgatgcaggt
ttgtctgaggcgagagactttgatcaaattgataacgctccagaggagaaagaaagaggt
attacaattaatacatctcacgttgagtatcaaacagctaaccgtcactatgctcacgtt
gactgtccaggtcacgcggattacgtaaagaacatggtaactggtgctgctcaaatggac
ggtgctattctagtggttgctgctacagatggtccaatgccacaaactcgtgaacacatc
ctgttaggtcgtcaagttggaattccacgtatcgttgttttcttaaacaaagttgatatg
gttgatgatgaagagttgttagagttagttgatatggaggttagagaattattgtctttc
tatgattatgatggagataatggtcctgttgtttctggttctgctttaggagctttaaat
ggtgagcaaaaatgggttgatacagttttagaattaatggaagctgttgataactggatt
gaagagcctttaagagaagttgataaagatttcttaatgcctattgaagatgtattctca
attacaggtcgtggaacagtggcaactggtcgtatagaaactggtattgctaatacagga
gattcagtggatattattggtatgggagctgagaaattaacttctactattactggtatt
gaaatgttccgtcaaatcttagatagaggagaagctggagataatgcaggtatcttatta
agaggtatcaataaagaggatatcaagagaggtatggtaatctgtaagccaggttcggta
actccacatgctaaatttaaagcagaggtttatatccttaagaaagaagaaggagggcgt
catactccattccataacaattatcgtccacagttctatgtacgtacaactgatgtaaca
ggtactattaacttacctgatggagttgaaatggtaatgccaggagataacttaacaatt
acagttgacttaatccaacctattgcattaaacgtaggtttacgttttgctatccgtgaa
ggaggtagaacagtaggagcaggtcaggtaactgaaatgttagactaa

DBGET integrated database retrieval system