KEGG   Thioflavicoccus mobilis: Thimo_0088Help
Entry
Thimo_0088        CDS       T02397                                 

Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
tmb  Thioflavicoccus mobilis
Pathway
tmb00400  Phenylalanine, tyrosine and tryptophan biosynthesis
tmb01100  Metabolic pathways
tmb01110  Biosynthesis of secondary metabolites
tmb01130  Biosynthesis of antibiotics
tmb01230  Biosynthesis of amino acids
Module
tmb_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:tmb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Thimo_0088
Enzymes [BR:tmb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     Thimo_0088
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 AAA_33 Cytidylate_kin Cytidylate_kin2 AAA_24 AAA_17 dNK AAA_16 AAA_5 AAA_22 TsaE ABC_tran Mg_chelatase AAA AAA_29 APS_kinase RNA_helicase AAA_PrkA NTPase_1 Ploopntkinase3
Motif
Other DBs
NCBI-ProteinID: AGA88963
UniProt: L0GQE1
LinkDB All DBs
Position
86711..87235
Genome map
AA seq 174 aa AA seqDB search
MIRAQNIFLVGPMGAGKSTIGRQLAEVLSYEFKDSDQEIQRRTGVDIPTIFEFEGEAGFR
DRERQILEELIQGERIVLATGGGAVLRPENRQDLTARGVVVYLHCSPEQQYARTARDRSR
PLLDTSDPLLRLRELMAERDPLYRQVADLVVSTERRGTASVVKEIRRRIESAEL
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgatacgcgctcagaatatctttctcgtcggtccgatgggtgctgggaagagcacgatc
gggcgccagctggccgaggtcctctcctatgaattcaaggatagtgaccaggagattcaa
cgccgcaccggcgtcgatatcccgaccatcttcgagttcgagggtgaggccggtttccgc
gatcgtgaacggcagatcctggaggaattgatccagggcgagcggatcgtgctcgccacc
ggcgggggggctgtgcttcgccccgagaaccgccaggatctgaccgcacgcggcgtggtc
gtctatctccactgtagccccgaacagcaatacgcccgcacggcgcgagaccgcagccgg
ccgctgttggatacgagcgatccgttgctgcggctgcgcgaactgatggcggaacgcgat
cccctctatcgccaggtcgccgacctggtcgtctcgacagagcggcgtggcaccgcgtcg
gtggtcaaggagatccgccgccgcatcgagagcgccgaactctag

DBGET integrated database retrieval system