KEGG   Thioflavicoccus mobilis: Thimo_0239Help
Entry
Thimo_0239        CDS       T02397                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
tmb  Thioflavicoccus mobilis
Pathway
tmb00020  Citrate cycle (TCA cycle)
tmb00270  Cysteine and methionine metabolism
tmb00620  Pyruvate metabolism
tmb00630  Glyoxylate and dicarboxylate metabolism
tmb00680  Methane metabolism
tmb00710  Carbon fixation in photosynthetic organisms
tmb01100  Metabolic pathways
tmb01110  Biosynthesis of secondary metabolites
tmb01120  Microbial metabolism in diverse environments
tmb01130  Biosynthesis of antibiotics
tmb01200  Carbon metabolism
Module
tmb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tmb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
tmb_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:tmb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Thimo_0239
   00620 Pyruvate metabolism
    Thimo_0239
   00630 Glyoxylate and dicarboxylate metabolism
    Thimo_0239
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Thimo_0239
   00680 Methane metabolism
    Thimo_0239
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Thimo_0239
Enzymes [BR:tmb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     Thimo_0239
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_N Ldh_1_C
Motif
Other DBs
NCBI-ProteinID: AGA89111
UniProt: L0GSY7
LinkDB All DBs
Position
255632..256618
Genome map
AA seq 328 aa AA seqDB search
MAKAPVRVAVTGAAGQIGYALLFRIVSGEMLGRDQPVILQLLELPLERAQRALKGVMMEL
EDCAFPLLAGVIGTSDPKVAFRDADYALLVGARPRGRGMERSDLLQENAKIFIEQGRALD
EVASRDIRVIVVGNPANTNALIAMKSASGLPRENFTSMMRLDHNRALSMLAGRAGKPVAA
VERMVVWGNHSPTMYPDIRYATIEGERASDLVDAAWYKETYIPSVAKRGAAIIEARGTSS
AASAANAAIAHMRDWALGTSGRWVTMGVVSDGSYGIPEGLVYGVPCTCEAGSWQRVEGLE
IDAFSRQMMDRTLEELLEERDGISPLLS
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atggccaaagcacccgttcgtgtggccgtcaccggcgccgctggccagatcggttatgcg
ctgctgttccgcatcgtcagcggcgaaatgttgggcagagatcaacctgtcatcctgcaa
ttgttggaattgccgctcgagcgggcgcaacgggccctcaaaggggtcatgatggagctg
gaggattgtgccttcccgctgttggcgggcgtgatcggcacctccgatcccaaggtcgcc
ttccgcgacgccgactatgccctgctggtcggtgcgcggccgcgcggccgtggcatggaa
cgcagcgacctgttgcaggagaacgccaagatcttcatcgagcagggccgtgccctggac
gaggtcgcctcgcgcgatatccgcgtcatcgtggtcggcaatcccgccaacaccaatgcc
ctgatcgccatgaagagtgcctcggggttgccgcgggagaacttcacttcgatgatgcgc
ctcgaccacaaccgcgccctctccatgctcgccggtcgcgccggcaagccggtggccgcg
gtggagcgcatggtggtctggggcaaccactctccgaccatgtaccccgatatccgctac
gccaccatcgagggcgagcgtgcctccgatctggtcgatgccgcctggtacaaggagacc
tacatccccagcgtcgccaaacgcggtgccgccatcatcgaggcgcgcggcacctcgtcc
gccgcttcggccgccaatgccgccatcgcccatatgcgtgactgggcattgggaaccagc
ggtcgctgggtgaccatgggcgtggtttcggacggctcctacggcattcccgagggcctg
gtctacggcgtgccctgtacctgcgaggcgggcagctggcaacgggtcgaagggctggag
atcgacgcgttctcccgccagatgatggatcggacgctcgaggagctattggaggaacgc
gacggcattagcccactgctctcctga

DBGET integrated database retrieval system