KEGG   Thioflavicoccus mobilis: Thimo_0765Help
Entry
Thimo_0765        CDS       T02397                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase, large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
tmb  Thioflavicoccus mobilis
Pathway
tmb00630  Glyoxylate and dicarboxylate metabolism
tmb00710  Carbon fixation in photosynthetic organisms
tmb01100  Metabolic pathways
tmb01120  Microbial metabolism in diverse environments
tmb01200  Carbon metabolism
Module
tmb_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:tmb00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Thimo_0765
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Thimo_0765
Enzymes [BR:tmb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Thimo_0765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: AGA89604
UniProt: L0GWD2
LinkDB All DBs
Position
834383..835801
Genome map
AA seq 472 aa AA seqDB search
MAKTYNAGVKDYRETYWMPDYTPKDTDILACFKITPQPGVPREEAAAAVAAESSTGTWTT
VWTDLLTDLDYYKGRAYAIEDVPGDDERFYAFIAYPIDLFEEGSVVNVFTSLVGNVFGFK
AVRTLRLEDVRFPIAYVMTCNGPPHGIQVERDIMNKYGRPLLGCTIKPKLGLSAKNYGRA
VYECLRGGLDFTKDDENVNSQPFMRWRQRFDFVMEAIDKAESETGERKGHYLNVTAPTPD
EMFKRAEHAKELGAPIIMHDYITGGWCANTGLAQWCRDNGVLLHIHRAMHAVIDRHPHHG
IHFRVLAKLLRLSGGDHLHTGTVVGKLEGDRAATLGWIDLLRESYVEEDRSRGIFFDQDW
GSMPGVFAVASGGIHVWHMPALVTIFGDDAVLQFGGGTLGHPWGNAAGAAANRVALEACV
EARNRGVAIEKEGKEVLTAAANNSPELKAAMETWKEIKFEFDTVDKLDVAHK
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atggccaagacctacaacgcaggcgtgaaagactatcgcgaaacctattggatgcccgac
tacaccccgaaagacacggacatcctcgcctgcttcaagatcactccgcagccgggcgtg
ccacgcgaggaggccgccgcggccgtcgccgccgagtcctcgaccggcacctggaccacg
gtctggaccgacttgctgaccgacctcgattactacaagggccgtgcctatgcgatcgag
gacgtgcccggcgacgacgagcgcttctatgccttcatcgcctatccgatcgacctcttc
gaggagggttcggtcgtcaacgtgttcacgtcgctggttggcaacgtcttcggcttcaag
gccgtgcgtacgctgcgcctggaggacgtgcgcttcccgatcgcctacgtgatgacctgc
aacggcccgccgcacggcatccaggtcgagcgcgacatcatgaacaagtacggccgtccg
ctgctcggctgcaccatcaagcccaagctcggcctgtcggcgaagaactacggccgcgcg
gtctacgagtgcctgcgcggtggcctcgatttcacgaaggacgacgagaacgtcaactcc
cagcccttcatgcgttggcgccagcgcttcgacttcgtcatggaggcgatcgacaaggcc
gagagcgagaccggcgagcgcaagggccactacctgaacgtcaccgccccgaccccggac
gagatgttcaagcgcgccgagcacgccaaggagctgggcgcgcccatcatcatgcacgac
tacatcaccggcggctggtgcgccaacaccggtctcgcccagtggtgccgcgacaatggt
gtcctccttcatatccatcgcgcgatgcacgccgtcatcgaccgccatccgcatcacggc
atccacttccgcgtgctggccaagctgttgcgcctctccggcggcgatcacctgcacacc
ggcaccgtcgtcggcaagctcgagggcgatcgcgccgcgactctcggctggatcgacctg
ctccgtgagtcctacgtcgaggaggaccgctcgcgcggcatcttcttcgatcaggattgg
ggatcgatgcccggcgtcttcgccgttgcctccggtggcatccacgtctggcacatgccg
gccctggtgaccatcttcggcgacgacgccgtgctccagttcggtggcggcaccctcggc
cacccctggggcaacgccgccggcgctgcggccaaccgtgtcgcgctcgaggcctgtgtc
gaggcccgcaaccgcggtgtggcgatcgagaaggagggcaaggaggtccttaccgccgcg
gccaacaacagcccggagctgaaggctgcgatggagacctggaaggagatcaagttcgag
ttcgacaccgtcgacaagctcgacgtggcgcataagtga

DBGET integrated database retrieval system