KEGG   Thioflavicoccus mobilis: Thimo_0766Help
Entry
Thimo_0766        CDS       T02397                                 

Definition
(GenBank) ribulose bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
tmb  Thioflavicoccus mobilis
Pathway
tmb00630  Glyoxylate and dicarboxylate metabolism
tmb00710  Carbon fixation in photosynthetic organisms
tmb01100  Metabolic pathways
tmb01120  Microbial metabolism in diverse environments
tmb01200  Carbon metabolism
Module
tmb_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:tmb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Thimo_0766
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Thimo_0766
Enzymes [BR:tmb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Thimo_0766
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: AGA89605
UniProt: L0GW53
LinkDB All DBs
Position
835997..836353
Genome map
AA seq 118 aa AA seqDB search
MSTMQDYQSSLEDVNSRKFETFSYLPAMSPEQIRQQVEYIVNKGWNPAIEHTEPENAFDH
YWYMWKLPMFGETDVETILAEAEACHKAHPNNHVRLIGYDNYAQSQGAAMVIYRGKPV
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atgagcacaatgcaggactatcagtcgagtctcgaagacgtcaatagccgcaagttcgag
accttctcgtatctgccggccatgagcccggagcagatccgccagcaggtcgagtacatc
gtcaacaagggctggaacccggccatcgagcacaccgagcctgaaaacgccttcgaccac
tactggtacatgtggaagctgccgatgttcggcgagaccgacgtcgagaccatcctcgcc
gaggccgaggcctgccataaggcgcacccgaacaaccacgtgcgtctcatcggctacgac
aattacgcccagtcccagggtgcggcgatggtgatctatcgcggcaagccggtctga

DBGET integrated database retrieval system