KEGG   Thioflavicoccus mobilis: Thimo_1264Help
Entry
Thimo_1264        CDS       T02397                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
tmb  Thioflavicoccus mobilis
Pathway
tmb00620  Pyruvate metabolism
tmb00680  Methane metabolism
tmb00710  Carbon fixation in photosynthetic organisms
tmb01100  Metabolic pathways
tmb01120  Microbial metabolism in diverse environments
tmb01200  Carbon metabolism
Module
tmb_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:tmb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Thimo_1264
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Thimo_1264
   00680 Methane metabolism
    Thimo_1264
Enzymes [BR:tmb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Thimo_1264
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 Img2
Motif
Other DBs
NCBI-ProteinID: AGA90061
UniProt: L0GVR8
LinkDB All DBs
Position
1369030..1371819
Genome map
AA seq 929 aa AA seqDB search
MKEFSDGEPLRRDIQLFTALLGEVLREHSRKRVLVVVERLRDGFMALRDADDPELRAKLM
KRIDGLDPQTLSEVVRAFNIYFGLVNTAEEIHGHLRRMDLISTGGPLWLGSFDQTVRELK
ADGVSPEKFQSLLEQLVYLPVFTAHPTEAKRRTILETFRRIFLVAQDLHRRRLNDEELEE
KLQAILTQIQILWKTDEVRVHKPQVTDEVRQGLHFFRESLFDAVPEVYRNLERAVRRIYG
PESRLRIPSFVRFGSWIGGDRDGNPSVKPETTELAVLMHHELVLEAYIERVAALRQMLSH
TDTLCRPSPAFLDSLDADEDYWVDTMGESLRRYTNEPYRRKLAIVRHRLDANLARARARM
AGDPADLPDGYGDARDFLADLYLIRDSLISHGDASAAAGELQDLIWLAETFGFHLVHLDV
RQESTRHTAAVAELFARQAGAPYYRAFTEEQKCVVLGEAIAHPHPFVIDKATLTPETRET
LEVFEVMARMRAEIGADVFGAYVISMTHSASHVMEVMLLARLAGLAGCHRGGWFCDIHIA
PLFETIEDLERIDEVMAALFDDATYQSLLKASGNQQEVMLGYSDSCKDGGILASGWKLYE
AQKKVIALADDHGVACRLFHGRGGTVGRGGGPTYEAILAQPVDTVHGQIKLTEQGEVLSY
RYANPETARYELAMGISGLIKASRCLIEEPAEERNDYLGIMDELARLGEEAYRDLVCDTE
GFLDYFYEVTPVDAIARLNIGSRPSHRKGSDRSLDSIRAIPWVFGWAQARHTIPAWYGVG
LALERWRNNDVERLAKLQRMYQEWPFFRALLSNTQMSLFKAEMQIAREYVRLARDQERAL
AIYERIQAEHQRTLTQVLNVAGLHSLMEDTPDLQLSLVRRNFYLDPLNYIQLAVIERYRD
EPVEEEREQWLDPLLRSINAIAAGMRNTG
NT seq 2790 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaattctccgacggcgaaccgcttcgccgcgatatccaattgttcaccgccctg
ctcggggaggtgctgcgcgagcacagtcgcaagcgggtgctcgtggtcgtcgagcggctg
cgcgatggtttcatggcgctgcgcgatgccgacgacccggagctgcgggccaagctgatg
aagcgcatcgacgggctcgatccgcagaccctgagcgaggtggtgcgcgccttcaacatc
tacttcggcctggtcaacaccgccgaggagatccacggtcacctacgccgcatggacctg
atcagcacgggcggtccgctctggctcggctcgttcgaccagacggtgcgcgagctcaag
gccgacggcgtgagtcccgagaagttccagagtctgctcgagcaactggtctacctgccg
gtcttcaccgcccatccgaccgaggccaagcggcgcacgatcctcgagacctttcgccgc
atcttcctcgtcgcccaggacctgcaccgtcggcggctcaacgacgaagagctcgaggag
aaactccaggcgatcctgacccagatccagatcctctggaagaccgacgaggtgcgcgtc
cacaaaccgcaagtcaccgacgaggtgcgccaggggctgcacttcttccgcgagtcgctg
ttcgacgccgtccccgaggtctaccgtaacctggagcgcgccgtgcgccgcatctacggg
cccgagagccgtctgcgcatcccgagcttcgtccgtttcggctcctggatcggcggggac
cgcgacggcaacccgagcgtcaagcccgagaccaccgagctcgccgtgttgatgcatcac
gagctggtcctcgaggcctacatcgagcgtgtcgccgccctgcgccagatgctgagccat
accgacacgctgtgccgcccatcgccggccttcctcgatagcctcgacgccgacgaggac
tattgggtcgacaccatgggcgagagcctgcgccgctacaccaacgagccgtatcggcgc
aagctcgcgatcgtccgccaccgcctcgacgcgaacctcgcccgggcacgtgcccgtatg
gccggcgaccccgcggacctgccggacggctatggtgacgcccgcgacttcctcgccgac
ctctacctgatccgcgactcgctgatcagccacggcgacgccagtgccgcggccggcgag
ctccaggacctgatttggctggccgagaccttcggtttccatctggtgcacctggacgtg
cgccaggagtcgacgcgccacacggcggccgtcgccgagctcttcgcccgtcaggccggc
gcaccctactaccgggccttcaccgaggagcagaagtgcgtcgtcctgggcgaggcgatc
gcccatccgcaccccttcgtcatcgacaaggcgacgctcacgcccgagacccgagagacc
ctcgaggtcttcgaggtgatggcccggatgcgcgccgagatcggcgccgatgtcttcggc
gcctacgtcatctcgatgacccactcggcgagtcacgtgatggaggtcatgctgctcgcg
cggctcgccgggctggccggctgtcaccgcggcggctggttctgcgacatccacatcgcg
cccctgttcgagacgatcgaggacctcgagcgtatcgacgaggtgatggccgcccttttc
gacgatgcgacctatcagtccctgctcaaggcctccggcaatcagcaggaggtcatgctc
ggctactcggattcgtgcaaggacggtggcattctggcctcgggttggaagctctacgag
gcgcagaagaaggtcatcgcactggccgacgaccacggcgtcgcctgtcggctcttccac
ggccgcggcggcaccgtcgggcgcggcggcggcccgacctacgaggccatcctggcccag
ccggtcgatacggtgcacggccagatcaagttgaccgagcagggcgaggtcctttcttat
cgttacgccaacccggagacggcgcgctacgaactggcgatgggcatcagcggcctgatc
aaggcgagccgttgtctgatcgaggagcccgccgaggagcgcaacgattacctcgggatc
atggacgagctggcccgcctgggcgaggaggcctatcgcgatctggtctgcgacaccgag
ggcttcctcgactacttctacgaggtcaccccggtcgatgcgatcgcccggttgaacatc
ggctcgcgaccctcgcaccgcaagggcagcgatcgctcgctcgactcgatccgtgccatc
ccgtgggtgttcgggtgggcccaggcgcgtcacacgatcccggcctggtacggcgtcggg
ctggccctggagcgctggcgcaacaacgacgtggagcgcctcgccaagctccagcgcatg
taccaggagtggccgttcttccgagcgctgttgagcaacacccagatgtcgctcttcaag
gccgagatgcagatcgcccgcgagtacgtccgcctcgcccgcgatcaggagcgggcgctg
gcgatctacgagcggatccaggccgagcatcagcgcaccctgacccaggtcctcaacgtc
gccggattgcacagcctgatggaagatacaccggaccttcagctctcgctcgtgcggcgc
aatttctacctcgacccgttgaactatatccagcttgcggtcatcgagcgttaccgtgac
gagccggtcgaggaagagcgcgagcagtggctcgaccccctgctgcgctcgatcaacgcg
atcgccgccgggatgcgcaatacgggctag

DBGET integrated database retrieval system