KEGG   Thioflavicoccus mobilis: Thimo_1405Help
Entry
Thimo_1405        CDS       T02397                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
tmb  Thioflavicoccus mobilis
Pathway
tmb00250  Alanine, aspartate and glutamate metabolism
tmb00410  beta-Alanine metabolism
tmb00430  Taurine and hypotaurine metabolism
tmb00650  Butanoate metabolism
tmb01100  Metabolic pathways
tmb01110  Biosynthesis of secondary metabolites
tmb01120  Microbial metabolism in diverse environments
tmb02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:tmb00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Thimo_1405
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Thimo_1405
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Thimo_1405
   00430 Taurine and hypotaurine metabolism
    Thimo_1405
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    Thimo_1405
Enzymes [BR:tmb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     Thimo_1405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AGA90199
UniProt: L0GY17
LinkDB All DBs
Position
complement(1534370..1535758)
Genome map
AA seq 462 aa AA seqDB search
MLTKKIEAISPEEIDALLTPAYGRRSMTQPVPKYRLADHEMAPDSAYDIVHDELMLDGNA
RLNMATFVTTWMEPQATKLMAEAFDKNLIDKDEYPQTAAIEARCVNIVSNLFHAPDEGVG
ASAIGSSEAVMLAGMALKWRWRARRRAQGRPTERPNLILGANVQVVWEKFCRYWEVEPKY
IPMEEGRYVITPDEVLARTDENTIGVVAILGTTFTGEFEPIEAIHEALVRQNAESGWEIP
LHIDAASGGFVAPFLHPELTWDFRLPLVKSINVSGHKYGLVYPGVGWVVWRSHEDLPEEL
IFHVNYLGGDMPTFTLNFSRPGNQVVGQYYNFLRLGRAGYTDIMETLRDTAMALARGIAE
LGPFELISDGSAIPVFAFKLKPEITRYSVFDVSERLRQHGWQVPAYTMPEHAEQVAVLRI
VVREGFSSDMAGMLLDDIGQVVEHFEGLRLHEPAPPAPQFAH
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgctgacgaagaagatcgaggcgatcagtccggaagagatcgacgccctgctcacgccc
gcctacgggcgacgcagcatgactcaaccggtgcccaaataccgccttgccgaccacgag
atggcccccgattccgcctacgacatcgtccatgacgaactgatgctcgacggcaacgcg
cggctcaacatggccaccttcgtcaccacctggatggagccgcaagccaccaagctgatg
gccgaggccttcgacaagaacctcatcgacaaggatgagtacccgcagacggcggccatc
gaggcacgctgcgtcaacatcgtctccaacctgttccacgcccccgacgaaggcgtcggg
gcctccgccatcggctccagcgaggcggtgatgctggccggcatggccctcaaatggcgc
tggcgggcgcggcggcgggcgcagggtcgcccgaccgagcggcccaacctgatcctcggc
gccaacgtccaggtcgtctgggagaagttctgccgctactgggaggtcgagcccaaatac
atcccgatggaggaagggcgttacgtgatcacccccgacgaggtcctggcgcgcaccgac
gaaaacaccatcggcgtcgtcgcgatcctcggcaccactttcaccggcgagttcgagccg
atcgaggcgatccacgaggccctggtgcgccagaacgccgagagcggctgggagatccca
ctgcacatcgatgcggccagcggcggcttcgtcgcccccttcctgcaccccgagctcacc
tgggacttccgtctgccactggtcaaatcgatcaacgtctcgggccacaagtacggcctc
gtctacccgggcgtcggctgggtcgtctggcgcagccacgaggacctacccgaggagttg
atcttccacgtcaactacctcggcggcgacatgccgaccttcacgctgaacttctcgcgc
ccaggcaaccaggtcgtcggccagtactacaatttcctgcgcctcgggcgcgccggctat
accgatatcatggagacgctgcgcgacacggccatggcgctggcgcgcggcatcgccgag
ctcgggccgttcgagctgatcagcgatggcagcgccatcccggtcttcgccttcaagctc
aagcccgagatcacccgctacagcgtcttcgacgtctccgagcggctgcgccagcacggc
tggcaggtgcctgcctacacgatgcccgagcacgccgagcaagtcgccgtgctgcgcatc
gtcgtacgggagggcttcagctcggacatggccgggatgctgctcgacgacatcggccag
gtggtagagcacttcgaaggcctgagattgcacgagccagcgcccccggcaccccagttc
gctcactga

DBGET integrated database retrieval system