KEGG   Thioflavicoccus mobilis: Thimo_2190Help
Entry
Thimo_2190        CDS       T02397                                 

Definition
(GenBank) signal transduction histidine kinase
  KO
K02668  two-component system, NtrC family, sensor histidine kinase PilS [EC:2.7.13.3]
Organism
tmb  Thioflavicoccus mobilis
Pathway
tmb02020  Two-component system
Brite
KEGG Orthology (KO) [BR:tmb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Thimo_2190
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tmb01001]
    Thimo_2190
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:tmb02022]
    Thimo_2190
   02035 Bacterial motility proteins [BR:tmb02035]
    Thimo_2190
Enzymes [BR:tmb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     Thimo_2190
Protein kinases [BR:tmb01001]
 Histidine kinases
  NtrC family
   Thimo_2190
Two-component system [BR:tmb02022]
 NtrC family
  PilS-PilR (type 4 fimbriae synthesis)
   Thimo_2190
Bacterial motility proteins [BR:tmb02035]
 Pilus system
  Twitching motility proteins
   Thimo_2190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA HATPase_c_2 PAS_8 HATPase_c_5 PAS_7 PAS
Motif
Other DBs
NCBI-ProteinID: AGA90938
UniProt: L0GVY4
LinkDB All DBs
Position
2432689..2434317
Genome map
AA seq 542 aa AA seqDB search
MSDPVPYSFAQHSAKPPIEPSPYPNWAILRWLFFLRLFIALSLISAFAIRGALPDDVGNN
GTLIWTVLPIYALTLLLSAIALLRQRPRPEHQLQLTIAVDIIVFTLVMHAAGGVDSGLGL
LLAIAVATGALLMEGRLSLFFASMAALAVIVEETFTQIHHDVASPNYTQAGLLGITFFTV
ALLAQILYRRIRAAEWLAARRNVDIADLSKLNAFIIQSMSTGVLIVDGERQLQMLNHAAT
QLLGKDMAHPGAPLAAAAPRLAAWLDASVKTSIKANQRPATTIHVGNRELRPTLQWLGEQ
RASGIVIFLEDQQELTKEAQQIKLASLGTLTASIAHNIRNPLSAISHAAQLLAESPQLSD
DDRHLLAIVRRNGERIEEIIQSILQLSRRNQAEPEPIELIPWLNQLCDDFRASHGIGPET
ISLQPPHETNPIVTADPRHLSQILSNLCENALKHGEYKDRPPSIELRIERNAKLIFLEVL
DSGPGIDPEKAQEIFNPFYTTSASGTGLGLYIARELAETNGALLEYIARQPQGCCFRLTF
QT
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgaccccgtaccctactccttcgcccaacactcggccaagccgcccatcgaaccc
agcccgtatccgaactgggccatcctgcgttggctgtttttcctccggctattcatcgcc
ctgagcctgatttcggccttcgcgatccgcggcgcgctaccggatgatgtcggcaataac
gggactctgatctggaccgtcttgccgatctacgcactgacactgctcctgagcgccatc
gcgctgctacgacagcgcccccgcccggaacaccaactccagttgacgatcgcggtcgac
atcatcgtcttcacgctcgtgatgcacgccgcaggcggtgtcgacagcggactcggattg
ctactcgccatcgccgtcgcgaccggcgccctgctgatggaaggacgactgtcgctgttc
ttcgcctcgatggccgccctggccgtcatcgtcgaggaaaccttcacacagatccatcac
gacgtcgcgagtccgaactacacacaggccgggctccttggcatcaccttcttcaccgtc
gccctccttgcccagatcctctaccggcgcatccgggccgccgagtggttggcggcgcga
cgcaacgtcgacatcgccgatctctccaagctcaatgccttcatcatccagagcatgtcg
accggggtcctgatcgtcgatggcgaacgccagctccagatgctcaaccacgcggccacg
caactcctcggcaaggacatggcccaccccggggccccgttggcagccgcggccccacgg
ctcgccgcctggctggatgcctcggtgaagacatcgatcaaggccaaccaacgcccggcg
acgaccatccatgtcggcaatcgcgagctgcgcccaaccctccagtggctcggcgagcag
cgggccagcggcatcgtgatcttcctcgaagatcagcaggaactgaccaaggaggcgcag
cagatcaagctcgcctcgctcggtacgctgacggcgagcatcgcgcacaacattcgcaat
ccgctgagcgccatctcccacgccgcccaactgctagccgaatcgccacagctcagcgat
gacgaccgccatctcctcgccatcgtgcggcgcaacggcgagcgcatcgaggagatcatc
cagagcatcctccagctctcgcgccgcaaccaggccgaacccgaaccgatcgaactgatc
ccctggctgaaccagctgtgcgacgacttccgcgccagccacggcatcggcccggagacc
atctcgttgcagccacctcacgagacgaacccgatcgtcacggccgatccgcgccacctg
agccagatcctgagcaatttgtgcgagaatgccctcaaacacggagagtacaaggaccgc
ccgccgagcatcgaactccgtatcgagcgcaatgcgaaattgatctttctcgaggttctc
gacagcggccccgggatcgaccccgaaaaggcgcaagagatcttcaaccccttctatacg
accagcgccagcggcaccggactcgggctctatatcgcccgcgagctggccgagaccaat
ggcgccctactggagtatattgcccggcagccgcagggttgctgttttcgcctgaccttc
cagacctga

DBGET integrated database retrieval system