KEGG   Thioflavicoccus mobilis: Thimo_3254Help
Entry
Thimo_3254        CDS       T02397                                 

Definition
(GenBank) ADP-ribosyl-(dinitrogen reductase) hydrolase
  KO
K05521  ADP-ribosyl-[dinitrogen reductase] hydrolase [EC:3.2.2.24]
Organism
tmb  Thioflavicoccus mobilis
Brite
KEGG Orthology (KO) [BR:tmb00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Thimo_3254
Enzymes [BR:tmb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.24  ADP-ribosyl-[dinitrogen reductase] hydrolase
     Thimo_3254
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADP_ribosyl_GH Bombinin
Motif
Other DBs
NCBI-ProteinID: AGA91932
UniProt: L0H1K7
LinkDB All DBs
Position
3562984..3563928
Genome map
AA seq 314 aa AA seqDB search
MFVSDPRIELQRSGRLSADHLLRWRAAAAYLGLAIGDALGATVEFMTPREIHEVHGEHRD
IAGGGWLRLRKGRVTDDTEMSLVLGRTILAHGRVEPQAVAEGFSDWMRTKPVDIGHTVRR
GISLYRRTGTVEVPENDYDAGNGACMRCLPVALATLGAPVEEVAAANLRQSHVTHHSTLA
DLGTLCVIRMVQTALLGGTRTALRQLADELVAADKRYAYDRKRIENPGGYIVETLRAVFQ
ALFSTDDFETALIDVVNRGGDADTTGAILGMIAGPLYGFDAIPRRWRRTLDADTQQACLT
QSQELIALSASHRQ
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgtttgtttcggacccgaggattgagctccagcggagtggtcggctctctgccgatcac
ctgctacgctggcgtgccgcggccgcctatctcggccttgccatcggcgatgccctgggg
gccacggtcgaattcatgaccccgcgggagatccacgaggtccacggcgaacaccgcgac
atcgccggcggcggttggctgcggctgcgtaagggccgcgtcaccgacgacaccgagatg
agcctggtcctcggacgcacgattctcgcccacggccgggtcgagccacaggccgtcgcc
gagggcttcagcgactggatgcggaccaagccggtcgacatcggccatacggtgcgccgt
gggatctcgctctaccggcgcaccggtacggtcgaggtgccggaaaacgactatgacgcc
ggcaacggcgcctgcatgcgttgcctgccggtggcgctcgcgaccctcggtgccccggtg
gaagaagtcgccgccgccaacctgcgtcaatcccacgtcacccaccacagcacgctggcc
gacctcggcaccctgtgcgtcatccgcatggtgcagactgccctactgggcggcacccgc
accgctctacgtcaactcgccgatgaactggtcgccgcggacaaacgctacgcctacgac
cgcaagcgcatcgagaacccgggtggctacatcgtcgagacattgcgagcggtcttccag
gccctgttctcgaccgacgacttcgaaaccgcgctgatcgacgtcgtcaatcgcggcggc
gacgccgataccaccggcgccatcctcggcatgatcgccggccccctctacggcttcgac
gccatcccgcggcgctggcggcgcaccctcgatgccgacacccaacaggcctgcctgacc
cagagccaagagctaatcgcactctcggcatctcatcggcaatga

DBGET integrated database retrieval system