KEGG   Thioflavicoccus mobilis: Thimo_3711Help
Entry
Thimo_3711        CDS       T02397                                 

Definition
(GenBank) ATP-grasp enzyme, D-alanine-D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
tmb  Thioflavicoccus mobilis
Pathway
tmb00473  D-Alanine metabolism
tmb00550  Peptidoglycan biosynthesis
tmb01100  Metabolic pathways
tmb01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:tmb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Thimo_3711
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Thimo_3711
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Thimo_3711
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:tmb01011]
    Thimo_3711
Enzymes [BR:tmb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Thimo_3711
Peptidoglycan biosynthesis and degradation proteins [BR:tmb01011]
 Precursor biosynthesis
  Amino acid ligase
   Thimo_3711
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C ATP-grasp_4 ATP-grasp_3 RimK
Motif
Other DBs
NCBI-ProteinID: AGA92365
UniProt: L0H3W3
LinkDB All DBs
Position
pTHIMO01:complement(7826..8827)
Genome map
AA seq 333 aa AA seqDB search
MRVVLVENIVQAVLAGESRDIASDREMEVIPGLVADALTTRGHDVSILPANWDLPANIGK
VEVDIVLNLAEGFAGSNGHEWLVPAILEQAGVPYTGADAGNILLTRDKLVTKTLLAAHNV
TVPRHQIIRRHSDLSVREIGFPIIAKPLREEASIGIGKDSVVVTEAQWKRRVEILLEIYK
QPVLCEEYVQGREFSIGVWGNNHVEALPMVEFVFPCVDPLQRFRSFEHKWLGDQEVMVAA
EGVADVLREQASTIACLAHRVLNCRDYSRADFRLSADGRLFFLEHNYNPGIGPNTHGLSN
TFTRQAELAGFSYEAFLEKLMEIARGRYQGLER
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtggtacttgttgagaatattgtgcaggcggtgctcgctggagaatcgcgtgat
attgcaagtgaccgagaaatggaggttataccggggcttgttgcagacgcgttaacgact
aggggacatgacgtgtcgattctaccggccaattgggacttgccggcaaatatcgggaag
gtagaagtggatatcgtactgaatttggcagaaggatttgcaggtagcaacggccatgag
tggctagtgcctgccatattagagcaagcgggagtgccatatactggcgcagatgcgggt
aacatattgttaacaagggacaagctcgtcacgaaaactttgctcgcggcgcacaatgtt
accgtgccacggcatcaaattatcagacggcattccgatctcagtgtgcgtgaaattggg
tttccaattattgcgaagccattgagagaagaagcgagcattggtattggaaaggactcc
gttgtggtaacggaggcgcaatggaaaaggcgggtagagatcctcttggaaatttataag
cagccggtgctttgcgaggagtacgtacaagggcgggaattttctatcggcgtatggggt
aacaaccatgtcgaagctttgccgatggtagagttcgtctttccctgtgttgatccatta
cagcggttccggtcgttcgaacataaatggctgggagatcaagaagtgatggtggcagcg
gaaggtgtggcggatgtgctccgtgagcaagcgagcactatcgcatgtctagcgcatcgt
gtgctcaactgtcgagactatagtagggcggattttcggctgtcggcggacgggaggctg
ttcttcttggagcataactacaatccaggaataggaccgaacacgcatggattgagtaat
accttcacgcggcaggcggagttggcgggattttcgtatgaagcgttcttggaaaagttg
atggaaatcgcaagaggtcgataccaaggattggagcgatga

DBGET integrated database retrieval system