KEGG   Tatlockia micdadei: LMI_0322Help
Entry
LMI_0322          CDS       T03810                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
tmc  Tatlockia micdadei
Pathway
tmc00473  D-Alanine metabolism
tmc00550  Peptidoglycan biosynthesis
tmc01100  Metabolic pathways
tmc01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:tmc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    LMI_0322 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LMI_0322 (ddl)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    LMI_0322 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:tmc01011]
    LMI_0322 (ddl)
Enzymes [BR:tmc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     LMI_0322 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:tmc01011]
 Precursor biosynthesis
  Amino acid ligase
   LMI_0322 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 ATP-grasp_3 RimK GARS_A
Motif
Other DBs
NCBI-ProteinID: CEG59682
UniProt: A0A098GCH0
LinkDB All DBs
Position
I:333549..334640
Genome map
AA seq 363 aa AA seqDB search
MSKINLALLYGGKSGEHEISLISAASVLAHLDTNKYNIIPIGMDKDGRFYQNDYQELLAY
KEGLPVITPRSRPLASLLVDGHFAVDAEIAFPVVHGPLYEDGCLQGILELAGVAYVGCDV
LSSAIGMDKDIARRIACNDEIRSARYRVLSWHSSAQEKQQFCQQVAAELGWPLFVKPCSL
GSSVGTHKVKNSEELSSAIEDALRYDETILVEEYIPGREIELAVLEGKVPSAPPRVSIAG
EICVNHADGFYSYTAKYLESHQTELHVPAKLDEKITKQLQGIAAEIFTRLKCKGMARVDF
FVNEQEGDIYFNEINTLPGFTSISMYPKLWQASGLAYSELLDELVSLAMTHHRCRRQLVT
SYQ
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaataaatctagcgctgctctacggtggcaaatccggcgaacatgaaatttcc
ctcatctcagcagcctcagtgttagcgcatctggatacaaataaatacaatattattcct
atcggaatggataaagacgggcgattctaccaaaatgattaccaggaattgttagcttac
aaggagggcttgcctgtgataactccgcgctctcgtccattggcaagtttactggttgac
gggcattttgcagtcgatgctgagattgcttttcccgttgtgcacggtcccctctatgaa
gatgggtgtttgcaaggtatattggaattagccggtgttgcttacgttggttgtgatgtt
ttatcgtctgctattggtatggacaaagatatcgcgcgacgtattgcctgcaatgatgag
atccgttcagcacggtatcgagtattatcttggcatagctcggcccaggaaaagcaacaa
ttttgccagcaagtggctgctgaattaggttggccattgtttgttaaaccttgttcattg
ggatccagcgttggtacccacaaagtcaaaaatagtgaagaactctctagcgctattgaa
gatgcgttgcgctatgatgagactatcttagttgaagagtatatcccaggaagggagatt
gaattggcagtgttagaaggtaaagtgccctcagcacccccgcgggtgagtatagcaggt
gaaatttgcgtgaatcatgcagatggattctactcttacacagcaaaatacttagaaagc
catcagacagagttacatgttccagcgaaactggatgaaaaaataacaaagcaattacaa
ggaattgctgctgaaatttttactcgcttaaaatgcaaaggaatggcgcgtgttgacttt
tttgtgaatgagcaagagggtgatatttattttaatgaaattaacacgctaccaggcttt
acttcgattagcatgtatccgaaactgtggcaggctagtggtttagcgtattccgaactt
ttagatgagttggtcagtttggcaatgacgcatcatcgttgccgacgacagctggtgact
agttatcagtaa

DBGET integrated database retrieval system