KEGG   Tatlockia micdadei: LMI_2484Help
Entry
LMI_2484          CDS       T03810                                 

Definition
(GenBank) putative D-alanyl-meso-diaminopimelate endopeptidase
  KO
K07259  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase (penicillin-binding protein 4) [EC:3.4.16.4 3.4.21.-]
Organism
tmc  Tatlockia micdadei
Pathway
tmc00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:tmc00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LMI_2484
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:tmc01002]
    LMI_2484
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:tmc01011]
    LMI_2484
Enzymes [BR:tmc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     LMI_2484
   3.4.21  Serine endopeptidases
    3.4.21.-  
     LMI_2484
Peptidases and inhibitors [BR:tmc01002]
 Serine peptidases
  Family S13: D-Ala-D-Ala peptidase C family
   LMI_2484
Peptidoglycan biosynthesis and degradation proteins [BR:tmc01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   LMI_2484
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S13 Beta-lactamase2 Peptidase_S11
Motif
Other DBs
NCBI-ProteinID: CEG61748
UniProt: A0A098GGY3
LinkDB All DBs
Position
I:complement(2605468..2606898)
Genome map
AA seq 476 aa AA seqDB search
MRTYLLAFTLFVSCFSIASFAEETVEATFLDTKIQDVLSDIKEDINIGIYVQDAKTGKVL
FKKNVNRYFMPASNQKLFTAFAALHSLGPDFTYRTQLFLDYTKIRKGVLRDNLYLQFSGD
PVFTVEQLESLINSLAEVGILRIKGKIIIDDTAFDQMGMSPGTSWDDQDFCWGSPISALI
INHNCVKATLIPAPEPGQLAKLELPNYPQSMHFINQVMTSPASTKNCRVKVKRSDETTYV
MSGCLSASASPYPVEMAISNPRDNVKLLLKHFLEKNHIGVTGEVEFKNFETPAKPFARQD
SPPLKNLVATMLKESDNTIADALFKTMGANYAHEAGSFANGNSAVRDILAQSVQLNFPKT
TLIDGAGSSRYNFLTPAQIVTLLQKIFLSPGASDFISSLAISGVDGTLKDRMNDSVALGK
VHAKTGSETAVTSLSGYLETNKKQTLIFSIMINGFVDPAAKYKALEDKLCKVMIES
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgagaacatatctcttagcttttacgctgtttgtatcgtgcttttcaattgcctccttt
gcagaggaaaccgttgaagctacctttcttgatacgaaaatacaggatgtcttaagtgat
attaaagaggatattaatatcggtatttatgtgcaagatgcaaaaactggtaaagtcctt
tttaaaaagaatgtgaatcgctattttatgccggcgagcaatcaaaaattattcacagcg
tttgcagcacttcactcgcttggtcctgattttacttatcgaacccaactttttcttgat
tatactaaaatccgtaaaggggttttgagggataacctatacctacaattttcaggtgat
cccgtattcactgtggaacaactggaatcactcatcaattcattagcagaagtaggcatc
ctccgtatcaagggtaaaatcattattgatgatactgcctttgatcaaatgggtatgagt
ccgggaacttcttgggatgatcaagatttttgctggggttcgccgataagtgctttaatt
attaatcataattgtgtcaaagcaaccttaattcctgctcctgaacctgggcaacttgcc
aaacttgaactgcctaactacccacaatccatgcattttattaatcaagttatgaccagt
cctgcttcaacgaagaactgtagagtgaaagtgaagcgcagtgatgagacaacttatgtg
atgagcgggtgtcttagtgcttccgctagcccttaccccgtcgaaatggcaatcagtaat
ccgcgagataatgtaaaactattgttaaagcattttttagaaaaaaatcacataggtgtc
actggggaagtggagtttaaaaattttgagactccagccaaaccgtttgctcgtcaagat
tctccaccgttaaaaaacttagtggcaacgatgttaaaagaatcggataacacgattgcc
gatgctttgtttaagacaatgggagcaaactatgctcacgaagcaggaagttttgctaat
gggaatagtgcggtgcgcgatattttggcccaatcggtacagctgaattttcctaaaacc
acgcttattgatggtgcaggcagttctcgctataattttttaaccccagcacaaatagtt
accctactacagaaaatctttttatctccaggggcatctgattttatttcttctcttgcc
atatcaggcgtagatggcacacttaaggatagaatgaacgattctgtagctttagggaaa
gtacatgcaaagacaggttctgaaaccgcagtgacatctttgtcgggttatcttgagact
aacaaaaagcagaccctgattttttcaatcatgatcaatggatttgttgatccagctgct
aaatataaggcgttggaagataaactatgcaaagttatgattgagtcttaa

DBGET integrated database retrieval system