KEGG   Thermosipho melanesiensis: Tmel_0081Help
Entry
Tmel_0081         CDS       T00550                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
tme  Thermosipho melanesiensis
Pathway
tme00473  D-Alanine metabolism
tme00550  Peptidoglycan biosynthesis
tme01100  Metabolic pathways
tme01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:tme00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Tmel_0081
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Tmel_0081
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    Tmel_0081
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:tme01011]
    Tmel_0081
Enzymes [BR:tme01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Tmel_0081
Peptidoglycan biosynthesis and degradation proteins [BR:tme01011]
 Precursor biosynthesis
  Amino acid ligase
   Tmel_0081
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C ATP-grasp_3 ATP-grasp_4 GARS_A GSH_synth_ATP
Motif
Other DBs
NCBI-ProteinID: ABR29958
UniProt: A6LJ57
LinkDB All DBs
Position
complement(85686..86618)
Genome map
AA seq 310 aa AA seqDB search
MKIAVVCDKNINNEEKKMINAIKDAISKKYKCEIVRFDEDFLRKINKYDFVFNLSNKGGK
EVKQVHVPSVLDFLGIPYTSSNTFTHAICLDKITTKIIMKQYNIPTPDFYVVDVGEIPNY
IDGKYIVKPPREGSAKGITKDSIVDNLEDLKKQVKKIHDEFSQPALVEKFIDGREFSVGV
IGNKKPEVLPILEIDFSSLPKELERFYSYRVKHYYGEQTRYICPANLDVDLEKKIKYYAQ
KLFRVLNLRDYARMDLRIKGGEIYFLEVNSMPQLVPVYSDITKMAKAAGCDYDKLVLKIL
EISMERWGLL
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatagccgtagtttgcgataaaaatataaacaatgaagagaaaaaaatgataaat
gctataaaagatgcaatttccaaaaaatacaaatgtgaaattgttagatttgatgaggat
tttttgagaaaaataaataaatatgattttgtttttaatctttctaacaaagggggaaag
gaagtaaaacaagtccatgttccatccgtgttagattttctaggtattccatatacttct
tcaaatacatttacacatgccatttgtcttgataaaatcacaacgaaaataataatgaag
caatataatattccaacaccggatttttatgtggttgacgtaggtgaaataccaaattat
atagatggtaagtacatagtaaaaccaccacgtgagggaagtgcaaagggtattacaaaa
gattcaatagtggataatttagaagatttaaaaaaacaggtgaaaaaaatacatgatgaa
ttttctcagccggcacttgttgaaaaattcatagatggtcgggagtttagtgtaggggta
ataggaaataaaaagcctgaagtattacctatacttgaaatagatttttcgtcgttacca
aaagaacttgaacgattttattcatatagagtaaaacactattatggagaacaaacaagg
tatatttgtccggctaatttagatgttgatcttgagaaaaaaataaaatattatgcacaa
aaactttttagggtgctgaatttaagagattatgctagaatggatttaagaataaaaggc
ggtgaaatatactttttagaagttaattctatgccacaacttgttcctgtttattctgat
attacaaaaatggcgaaagcggctggttgtgattatgataaattggttttaaagattttg
gaaatttctatggaaaggtggggtttgttatga

DBGET integrated database retrieval system