KEGG   Thermosipho melanesiensis: Tmel_0307Help
Entry
Tmel_0307         CDS       T00550                                 

Definition
(GenBank) Type II site-specific deoxyribonuclease
  KO
K01155  type II restriction enzyme [EC:3.1.21.4]
Organism
tme  Thermosipho melanesiensis
Brite
Enzymes [BR:tme01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.4  type II site-specific deoxyribonuclease
     Tmel_0307
Prokaryotic defense system [BR:tme02048]
 Restriction and modification system (R-M system)
  Type II R-M system
   Restriction endonucleases
    Tmel_0307
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DpnII EcoRII-C
Motif
Other DBs
NCBI-ProteinID: ABR30179
UniProt: A6LJS8
LinkDB All DBs
Position
complement(314157..314975)
Genome map
AA seq 272 aa AA seqDB search
MDYKEFINSLSDTNATLSYFTDFKKITDKISKIEIKLHQLNYLIGKRDLRKAVYELFNEN
PSVFDVLNILIAVRDKNKKVVNDEGNIVFLKNYFENPESIYKYLKETGLEEVFIREDIKN
VVDYVFGIEVGLDTNARKNRSGKIMAKIVENIFEKNGIKFSKEIKSDLFPEIMNLGYDLK
CFDYVVQTTEKCYLIETNYYNVGGSKINETTRAYIEIAKKINEYKNYEFVWITDGKSWLS
AKNKIKEAFQHIKHIYNLKTIKRFIEILKEEI
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atggattataaggaatttattaattcattgtcagatacaaatgcaacattaagttacttt
acagattttaaaaaaattacagataaaatttcaaaaatagaaattaaattacatcaatta
aattatttaattggaaaaagggatttgagaaaggctgtatatgaactttttaatgagaat
ccttctgtgttcgatgttcttaacatattaattgctgtcagggacaaaaacaaaaaagtt
gtgaacgatgaaggaaatattgtttttttaaaaaactattttgaaaatccagaaagtatt
tataaatatttgaaagaaacaggtttagaagaggtttttataagggaagatataaaaaat
gttgtagattatgtttttggtatagaagttggtcttgatacaaatgcacgtaaaaatcgc
tcgggaaaaataatggcgaaaattgtagaaaatatatttgaaaaaaatggtataaaattc
tcaaaagaaattaaatcagatctttttccagagattatgaatcttggatatgatttaaaa
tgttttgattatgttgtccaaacaacagaaaaatgctatctaattgaaacaaattactat
aatgtaggaggttcaaaaattaatgaaacaactagagcatatattgagattgcaaaaaaa
ataaatgaatataaaaactatgaatttgtatggattactgatgggaaaagctggttatca
gctaaaaataagataaaagaagcttttcagcatattaaacatatttataatttaaaaact
attaaaagatttattgaaattttgaaagaggagatttaa

DBGET integrated database retrieval system