KEGG   Thermotoga maritima MSB8: THEMA_08495Help
Entry
THEMA_08495       CDS       T02976                                 

Definition
(GenBank) alpha-glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
tmi  Thermotoga maritima MSB8
Pathway
tmi00500  Starch and sucrose metabolism
tmi01100  Metabolic pathways
tmi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tmi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    THEMA_08495
Enzymes [BR:tmi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     THEMA_08495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphorylase DUF3417
Motif
Other DBs
NCBI-ProteinID: AHD18925
LinkDB All DBs
Position
complement(1630166..1632673)
Genome map
AA seq 835 aa AA seqDB search
MLLKETSLRGGEIVLEKLPENLKELESLAYNLWWSWSRPAQRLWRMIDSEKWEEHRNPVK
ILREVSKERLEELSKDEDFIALYELTLERFTDYMEREDTWFNVNYPEWDEKIVYMCMEYG
LTKALPIYSGGLGILAGDHLKSASDLGLPLIAVGLLYKHGYFTQQIDSDGRQIEIFPEYD
IEELPMKPLRDEDGNQVIVEVPIDNDTVKARVFEVQVGRVKLYLLDTDFEENEDRFRKIC
DYLYNPEPDVRVSQEILLGIGGMKLLKTLKIKPGVIHLNEGHPAFSSLERIKSYMEEGYS
FTEALEIVRQTTVFTTHTPVPAGHDRFPFDFVEKKLTKFFEGFESKELLMNLGKDEDGNF
NMTYLALRTSSFINGVSKLHADVSRRMFKNVWKGVPVEEIPIEGITNGVHMGTWINREMR
KLFDRYLGRVWREHTDLEGIWYGVDRIPDEELWEAHLNAKKRFIDYIRESIKRRNERLGI
NEPLPEISENVLIIGFARRFATYKRAVLLFSDLERLKRIVNNSERPVYIVYAGKAHPRDE
GGKEFLRRIYEVSQMPDFKNKIIVLENYDIGMARLMVSGVDVWLNNPRRPMEASGTSGMK
AAANGVLNASVYDGWWVEGYNGRNGWVIGDESVLPETEADDPKDAEALYELLENEIIPTY
YENREKWIFMMKESIKSVAPKFSTTRMLKEYTEKFYIKGLVNREWLERRENVEKIGAWKE
RILKNWENVSIERIVLEDSKSVEVTVKLGDLTPNDVIVELVAGRGEGMEDLEVWKVIHIR
RYRKENDLFVYTYTNGVLGHLGSPGWFYAVRVIPYHPRLPIKFLPEVPVVWKKVL
NT seq 2508 nt NT seq  +upstreamnt  +downstreamnt
atacttctgaaagaaacctctctgagaggaggagaaattgtgctggagaaacttcccgag
aacctgaaagagctcgagagccttgcctacaacctctggtggagctggtccagacctgct
cagagactctggagaatgatcgattcagaaaagtgggaggaacacagaaatcccgtcaaa
atactgagagaagtctcaaaggaaagactggaagaactatcgaaagacgaggacttcatc
gctctctacgaactgacgctcgagagattcacagactacatggaaagggaagacacctgg
ttcaacgtgaactatcccgaatgggacgaaaagatagtttacatgtgtatggaatacgga
ctgacgaaagcacttccgatctactctggaggactcggtatccttgccggagaccacctc
aaatcagccagtgatcttggccttcctctcatagccgtaggtcttctttacaaacacggg
tatttcactcaacagatagacagtgacggaagacagatcgagatctttccagaatacgac
atcgaagaactcccgatgaaacctctcagggatgaagacggaaaccaggtgatcgtagaa
gtacccatagacaacgatactgtaaaagcgcgtgtgttcgaggtacaggtcggaagggtg
aaactgtatcttctcgacactgacttcgaggaaaacgaggatagattcagaaagatctgc
gactatctctacaatcccgagcctgatgtgagagtttcccaggaaattctgctcggcatt
ggtggaatgaaactcctgaagactctcaagataaaacctggagtcatccacctgaacgaa
ggtcatcccgctttttcatccctcgaaaggataaagagctacatggaagaaggatattcc
ttcaccgaggcccttgagatcgtcagacagaccacagttttcacgacacacacccccgtc
cccgcaggtcacgacaggttcccgttcgatttcgtggaaaagaagctgacaaagttcttc
gaaggattcgaatccaaagaactgcttatgaaccttggaaaagacgaagacggaaatttc
aacatgacgtatcttgctttgagaacctcctcctttataaacggagtgagcaaacttcac
gctgacgtatcgagaaggatgttcaaaaatgtctggaagggagttccggtggaggagatc
cccattgaaggcatcacgaatggtgtccacatgggaacctggatcaaccgcgagatgaga
aaactgttcgacaggtacctcggtagagtctggagggaacacactgacctcgaaggaata
tggtacggagttgacagaatacccgatgaagaactctgggaagcgcatctgaacgcaaag
aaacgattcatagattacataagagaatccatcaaaaggagaaacgaaaggcttggaatc
aacgaaccactgccggagatcagtgaaaacgtgctcatcataggttttgccagaaggttc
gcaacttacaagagagccgtcctgctcttcagcgatctggaaagactcaagagaattgtc
aataattccgagaggccggtttacattgtgtacgctggaaaggcccacccgagagacgaa
ggtggaaaggagtttctcagaaggatctacgaagtttcacagatgcccgatttcaagaac
aaaatcatcgtactcgaaaactatgacatcggaatggctcgactcatggtgtcgggtgtt
gacgtgtggttgaacaatccaaggaggcccatggaggcaagcgggacaagtggtatgaaa
gctgcagcgaacggtgttctgaacgcgagtgtatacgatggctggtgggttgagggatac
aacggcagaaacggatgggtgataggtgatgaaagcgtgcttccagaaacagaagcggat
gatccaaaggatgccgaggctctgtatgagcttctcgaaaacgaaataatccccacctac
tacgaaaacagagaaaagtggatcttcatgatgaaagaaagcataaagagcgtggctcca
aaattcagcaccacccgcatgctcaaagagtacacggagaaattctacataaagggactt
gtgaacagggaatggctggagagaagagaaaacgtcgaaaaaatcggagcctggaaagaa
agaatcctcaagaactgggagaatgtttccatagagcgcattgttcttgaagattcgaag
agcgtagaagtaactgtaaaactgggcgatctcacaccgaacgacgtgatagtcgaactt
gtggctggaagaggagagggaatggaagatctcgaagtgtggaaagtgatacacatcaga
aggtacaggaaagagaacgatctattcgtttacacttacaccaatggtgttcttggtcat
cttggatctcccggatggttctacgcggtgagagtcataccgtaccatcccaggcttccc
atcaagttcctgcccgaagtaccggttgtctggaagaaggttctctga

DBGET integrated database retrieval system