KEGG   Tuber melanosporum: GSTUM_00005720001Help
Entry
GSTUM_00005720001 CDS       T01282                                 

Definition
(RefSeq) hypothetical protein
Organism
tml  Tuber melanosporum
SSDB OrthologParalogGFIT
Motif
Pfam: Cyclin_N Cyclin_C
Motif
Other DBs
NCBI-GeneID: 9181306
NCBI-ProteinID: XP_002837846
INRA: GSTUM_00005720001
UniProt: D5GBZ4
LinkDB All DBs
AA seq 587 aa AA seqDB search
MDAKPQRPSRAIRRQDENANRPIIHNKSANNVSSAAANAALGNMESQQSTGVGLRAAARR
TAFGDVSNTGKGNNVTTSGKESSKGGVTVVQDKQGQKATGAISKPAQRVQGLKPASSIAS
QSSVTSQHVAPSRNIVRKTTVYQDNKRPSPKRTSPKRTSPKVSRDAVVKKESQQFGRQAT
RPRSKGRASRPLSGLLRIKQHQAKGESPVYSDQASQSYSDRYLDEDQESTAAEAEDDDDE
DASEDDEAPGGAKAIKGQHEVISDYESDEGDDDETEYNSARARAGDNTTGVTTQVLVPKI
TSQTRKELSKVQREFFDDEDEGDISMVAEYGDEIFEYMRELEAKMLPNAHYMDHQSEIQW
SMRAILMDWLVQVHTRFNLLPETLFLTSNYVDRFLSAKVVSLGKLQLVGATALFVAAKYE
EINCPSVHEIVYMVDNGYTAEEILKAERFMLSMLHYELGWPGPMSFLRRISKADDYDLET
RTLAKYFLEITVMDERFVGSPPSFLAAGAHCLARHMLRKGEWTPAHTFYSGYTASQLEPL
IHTLVECCEKPKTHHGAVYDKFADRRYKRASLYVQNWMKNEESSDDE
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atggatgccaaaccacaacgtccctctcgcgctattcgccgtcaagacgagaacgcaaac
cgtcctataatccacaacaagtccgccaacaacgtctcttcagccgctgccaacgctgct
ttggggaacatggaatcgcagcaatccactggagtcggcctcagagccgctgcccgcagg
accgcgttcggcgatgtcagcaacacaggcaagggtaacaatgttactacctcaggcaag
gaaagtagcaagggtggtgtcactgtcgttcaggataagcaaggtcagaaggccactggc
gcgatctcgaaaccagctcagcgagtccagggactcaagccagcttcttcgatcgcttcc
cagtcttcggtcacgtctcaacacgttgctccatcgaggaacattgtccgaaagaccaca
gtttaccaagataacaagcgcccgagcccgaagaggactagtcccaagcgaaccagtcca
aaggtttcgcgagatgcggtcgttaagaaggaatcgcagcagttcggtagacaagctact
cggccccgtagcaagggtcgtgcgtctaggcctctgtcgggtcttttgagaataaagcaa
catcaagctaagggtgaatctccagtctattcggaccaagcatctcaatcctactctgat
agatacttggatgaggatcaagagagcaccgcagctgaagctgaagatgatgatgacgaa
gacgcttcggaggatgatgaggctccgggcggtgctaaggctattaagggtcaacatgag
gttatctcagactatgagagcgatgaaggagatgatgatgagactgagtacaacagcgca
agagcgcgtgccggagataatactactggggttaccacgcaagttcttgtgccaaagatc
acgtctcagacccggaaggaattgagcaaggtacagcgggagttctttgacgacgaggac
gagggtgatatttctatggttgcggaatatggcgatgaaatcttcgagtatatgcgtgag
cttgaggcgaagatgttgccgaacgcacattacatggatcatcaatccgagatccaatgg
tcaatgcgcgcgattctcatggactggctcgtccaggttcacacccggtttaaccttctt
cccgagactctcttcctcacctccaactatgtcgatcgcttcctctcggccaaggttgtc
tccctcgggaagcttcaacttgtcggagccacagcgctgtttgtcgccgccaagtatgag
gagatcaactgcccgtctgttcacgagattgtgtacatggtcgacaatggttataccgcg
gaagagattctcaaggcggagagatttatgctttcgatgttgcattatgaacttggttgg
cccggaccgatgagcttcttgagaagaatcagcaaggccgacgattatgatcttgagacc
agaacgctagcaaagtacttcttggagatcactgtcatggatgagagattcgttggaagc
cctccaagctttctcgctgccggagcgcactgtctcgccagacatatgttgaggaaggga
gagtggacacctgcacacaccttttattcgggttacactgcttctcagctggagccgttg
atccacacccttgtcgagtgctgcgagaagccgaagactcaccacggtgcggtatacgat
aagtttgctgatcggcggtacaaacgtgctagtttgtatgttcagaactggatgaagaat
gaggagagcagtgatgatgagtaa

DBGET integrated database retrieval system