KEGG   Tuber melanosporum: GSTUM_00006610001Help
Entry
GSTUM_00006610001 CDS       T01282                                 

Definition
(RefSeq) hypothetical protein
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
tml  Tuber melanosporum
Pathway
tml00500  Starch and sucrose metabolism
tml01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tml00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    GSTUM_00006610001
Enzymes [BR:tml01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     GSTUM_00006610001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase DUF1966 Alpha-amylase_C
Motif
Other DBs
NCBI-GeneID: 9187991
NCBI-ProteinID: XP_002838863
INRA: GSTUM_00006610001
UniProt: D5GEW1
LinkDB All DBs
AA seq 457 aa AA seqDB search
MVKFSSLIGFFGLVTLALAADSEAWKTRSIYFVLTDRFARTDDSTNACPNLGDYCGGTWK
GMQNQLDYIQGLGFDAIWITPIVSNTPGGYHGYWAKDIYSVNSNYGSADDLKSLINAAHA
KSMYVMVDIVVNHMGAGDITTFNPFNSSSYYHSSCSIDDYNDQRKVEQCQIAGLPDLKTE
DNTVRSLLHGWIRNLVSEYSIDGLRLDTVKHVEKDFWPGFTSAAGVHSMGEVFNGDPAYV
GPYQNYMPALVNFPMYYSISDCYARKYGFPNLVSQHDKVSSVFSRPELLGTFLDNHDVQR
FLSINNDWTLLKNALSYTMLARGIPILYGGTEQAYGGGNDPANREDLWRSGYDISGDLYT
FIQKLMKVKMASGGLGENDHVHLYTTDNCYAFSRASGRVVVVTTNGGSGSSGTYCFNTPK
PQGTVYTSGLGSAAYTAGPNGKICVPISNGQPEVLVS
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggttaaattctcttccttgatcggctttttcgggctggttactttggcgctagccgct
gacagcgaagcctggaaaacgaggtctatatattttgttctcaccgatcgattcgcgagg
acagatgacagcactaacgcctgtccaaacttgggcgattactgcggcgggacatggaag
gggatgcaaaaccagctggactatatccagggactcgggttcgatgcaatctggatcacc
ccaatcgtgagcaacacccccggcggttaccacggttattgggcaaaagacatctattcc
gtcaactccaattacggttccgcagacgacctcaaatccctcatcaatgcggcccatgca
aagagtatgtacgtaatggtggacatcgttgtcaatcacatgggtgccggggacatcaca
accttcaaccccttcaactcaagctcgtactatcacagcagctgcagcatcgacgactac
aacgaccaaaggaaggtcgagcaatgccagatcgctgggctcccggacctcaagaccgag
gacaacacagtgcgcagcctgctccacggctggatcaggaacctggtgtcggagtactcc
attgacggactgcgcctagacacggtgaagcacgtggagaaggacttctggcccggattc
accagtgctgcgggtgtgcactctatgggagaggtgttcaacggcgacccggcttacgtc
gggccttaccagaattacatgcccgcgcttgtcaactttcccatgtactactccatcagc
gactgctacgcgcgcaaatatggattcccgaacctcgtcagtcagcacgacaaggtcagc
tctgtgttctcccgtccggagctcctgggaacatttctggacaaccatgacgttcagcgc
ttcctgagcatcaacaacgactggactctcctcaagaacgctctctcatacaccatgctc
gcccgtggtattcccatcctgtacggtggtacagagcaggcgtacggtggcggaaacgat
cccgctaacagagaggatctctggaggagcgggtatgatatcagtggcgacctctacaca
ttcatacaaaagctcatgaaggtgaagatggcttccggtggactgggtgaaaatgatcat
gttcacttgtacaccaccgataactgctatgctttcagcagggctagtggccgcgttgtt
gtcgtcactactaatgggggaagtggtagcagcggaacttactgctttaacacgccaaag
ccgcaggggactgtgtacaccagtggtctcgggtcagctgcttacactgctggtcctaat
ggcaagatctgtgtgcccatttcgaatgggcagccagaggttcttgtgtcttaa

DBGET integrated database retrieval system