KEGG   Tuber melanosporum: GSTUM_00006625001Help
Entry
GSTUM_00006625001 CDS       T01282                                 

Definition
(RefSeq) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
tml  Tuber melanosporum
Pathway
tml00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:tml00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    GSTUM_00006625001
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tml02000]
    GSTUM_00006625001
Enzymes [BR:tml01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     GSTUM_00006625001
Transporters [BR:tml02000]
 Other Transporters
  Pores ion channels [TC:1]
   GSTUM_00006625001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_C GST_N_2 GST_C_3 GST_C_2 GST_N_4
Motif
Other DBs
NCBI-GeneID: 9188599
NCBI-ProteinID: XP_002838870
INRA: GSTUM_00006625001
UniProt: D5GEW8
LinkDB All DBs
AA seq 224 aa AA seqDB search
MSPPSITLYSHRAGPNPWKVDIVLRHLNIPFETVFIGINGEHKRPPYTNINPNGRVPSLI
DHSNNDFTIWESGAIMQYIVQKYDKEHKLLFDNFEDNMHVEQWLMFQMSGQGPYYGQAAW
FTRYHPEKVPSAIDRYVKEIKRVLGVLDAWLADKEYLVGGRLSIADIAFVPWHEALGFLD
NEEVNNWKKEFPNAAAWHERVMALPAAKASFEAKRKAGEAQQKQ
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgtctcctcccagcataaccctctactcccacagggccggtcctaatccgtggaaggtc
gacatcgttctccgccacttgaacatccccttcgaaaccgtcttcatagggatcaacggc
gagcacaagcgccccccatacaccaacatcaacccgaacggccgcgtaccctcactcatc
gaccactccaacaacgacttcaccatctgggagtccggcgcgataatgcagtacatcgtg
cagaagtacgacaaggaacacaaactgctcttcgataacttcgaggacaacatgcacgtg
gagcagtggttgatgttccagatgagcggccaaggaccgtattatggacaggcagcctgg
ttcactcgctatcatcctgagaaggtcccgagcgcgattgaccgctatgtgaaggagata
aagagggttcttggcgtcctcgacgcttggcttgcggataaggagtatctcgtcggtggg
aggttgtctatcgcggatatcgcgtttgttccgtggcacgaggcgttgggctttttggat
aatgaggaggtgaataattggaagaaggaattccccaatgctgcggcttggcacgagaga
gttatggcgttgccggctgcgaaggcgtcttttgaggccaagaggaaggcgggtgaagcc
cagcagaaacaatga

DBGET integrated database retrieval system