KEGG   Tuber melanosporum: GSTUM_00007799001Help
Entry
GSTUM_00007799001 CDS       T01282                                 

Definition
(RefSeq) hypothetical protein
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
tml  Tuber melanosporum
Pathway
tml03030  DNA replication
tml03410  Base excision repair
tml03420  Nucleotide excision repair
tml03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:tml00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    GSTUM_00007799001
   03410 Base excision repair
    GSTUM_00007799001
   03420 Nucleotide excision repair
    GSTUM_00007799001
   03430 Mismatch repair
    GSTUM_00007799001
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:tml03032]
    GSTUM_00007799001
   03400 DNA repair and recombination proteins [BR:tml03400]
    GSTUM_00007799001
Enzymes [BR:tml01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     GSTUM_00007799001
    6.5.1.6  DNA ligase (ATP or NAD+)
     GSTUM_00007799001
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     GSTUM_00007799001
DNA replication proteins [BR:tml03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    GSTUM_00007799001
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     GSTUM_00007799001
DNA repair and recombination proteins [BR:tml03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     GSTUM_00007799001
   NER (nucleotide excision repair)
    Other NER factors
     GSTUM_00007799001
   MMR (mismatch exicision repair)
    Other MMR factors
     GSTUM_00007799001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-GeneID: 9182620
NCBI-ProteinID: XP_002839724
INRA: GSTUM_00007799001
UniProt: D5GH90
LinkDB All DBs
AA seq 852 aa AA seqDB search
MASPSKKRKNFSNTQPTRTLHHFFNKQTATKKEALDSVLTPDPQLGPVALTDEQYAKRLA
EEWKQEDKAIRNATPSTHRESSRAGAKRGRSSSPSTKCAASSPHAHSGEEGWKDNLAAAT
LRASRAVTPVQKPNTPRILQEPKRIAASAEGALEIERAIDSMPLGEDPLNPEMARRECHL
CAPYSRIRPGKFNKVKDKDKDTLVNFLRILIRLDPDSLLPAVWLTTNDIGPSYETNEFGI
DGSIISKAIMKASGITPATLKKLNNKHGDPGDVAFEAKVKQRTLMMKKPTPLTIENVYAT
LVKISRASGKGSQEIKQRHIERLLVDAKGEEIRYLTRTLIRHLRIGAVKTTMLIALSRAF
SLSAPKGANWNTPEIPGSKEGRQELFTKAEEFLKQCHARRPNYNDIVPGLLRGGISSLEE
NCGTSIHSPLKPMLGSITRDLGEMLLKLKGCEFTCEYKYDGQRAQIHCDDNGKVSVFSRH
LELMTGKYPDLVQLVPNIRGEGVESFIMEGEVVAMDTETGLVKNFQTLAGRERKNVDVGR
ISVDVCLFAFDLMYLNGQELLSRPFRERRELLQSIRGYHPGLLPFIVRPKIFTPPASGPP
EGAQELESKQIRSRKGKEAAPVKRSSRVKPLLATYEPDKRLESWPKVKKDYTAATDTLDL
VPIAAWYGNGRKAAWWSPILLALHDPETGSFEAVCKCMSGFTDKYYIEMKDTLAPDGINT
SMTKRAYYEVADSLTPAIWFEPREVWEVAFADITVSPTYTAAGQFMEGRGKGLSLRFPRF
VRRREDKGVEEASTPEFLAGLFFKQERDSERISKAAVGGEKKTEGMEQDAEVDGQEFFKN
MRGEGAGSDVNL
NT seq 2559 nt NT seq  +upstreamnt  +downstreamnt
atggccagtccttccaaaaagaggaagaacttctccaacactcagccaaccagaacactt
caccacttcttcaacaaacaaacagctactaaaaaggaagctctagactcagttctgaca
ccagacccccaactaggcccagtggcacttacagatgagcaatacgcaaagaggctggcg
gaggaatggaagcaggaggataaagctatcagaaatgcgacaccgtcaacacacagggag
agtagtagggcaggagcgaagaggggtaggagcagctctccgagcacaaaatgcgcagcc
tcgagtccccacgcacacagcggagaagagggatggaaagacaatctagcggcggcaact
cttcgggcgtcacgagcagtcacccctgtccaaaaaccaaatacccccagaatcctgcaa
gaaccgaagagaatcgcggcatcggcagagggtgctctggagatagaaagagctatcgat
tcgatgccactcggtgaagacccacttaacccagaaatggccaggcgggaatgccactta
tgcgctccttactcacgcattcgtcctggtaaattcaacaaggtcaaggataaggataag
gataccctggtgaattttctaagaattttgatacggcttgatccagactctctacttccg
gccgtttggctaacgacaaacgatatcggtccttcgtatgagacgaatgagttcgggatt
gatgggtcgataatatcaaaagcgattatgaaggccagcgggataaccccggcaaccctt
aaaaagctaaataataaacatggtgatcctggggatgtcgcttttgaggcgaaggttaaa
cagaggaccttgatgatgaaaaagccaaccccactaactattgaaaatgtatacgcaaca
ctagttaagatctcccgagcatcggggaaaggctctcaagagatcaagcagcgccacata
gaacgcttacttgtcgacgccaaaggcgaggaaatccgatacctcactaggactctaata
cgccatctccgaatcggtgccgtaaagactacaatgctaatagcactctctcgtgccttt
tctttatctgctcctaagggggctaactggaatactccggaaattcctggcagcaaagag
ggaagacaagagttatttaccaaagcagaggaattccttaagcaatgccatgcccggagg
ccgaattacaatgacattgtaccaggtctactcagaggtgggatatcttccttggaggaa
aattgtggaacgagcattcacagccctctgaaaccaatgctgggtagcatcactcgagac
ctgggggaaatgctcttgaagttaaaaggttgtgaatttacttgcgagtataagtatgat
gggcaaagggctcagatacattgtgatgataatggaaaggtttccgtattcagtaggcac
ttggaattgatgacgggcaagtatccagatctagtgcagctagtgcccaatattcgtggc
gagggtgtagagtctttcatcatggagggagaggttgtagcaatggatactgagacaggg
ctcgtaaagaacttccaaacattagctggtagagaaagaaaaaatgtggatgtgggaaga
attagtgttgatgtctgtctatttgcgtttgatctcatgtatttgaacggtcaagaatta
ctctctcggccattccgcgaacgcagagaactcctgcagagcatacgtggataccatcca
ggactccttccattcatcgttagacctaaaatcttcacccctccagcttccgggccaccc
gaaggggcacaggaactagaatccaaacaaattcgctccagaaagggcaaagaagcagcc
cctgtcaagaggagctcccgagtaaaacctttattagcgacgtacgagccagacaaacgt
cttgagtcctggccaaaagtcaaaaaagactacactgctgcaaccgacaccctcgatcta
gttccgatagcggcctggtacggcaatggccgaaaagccgcctggtggtcgccgatcctc
ctcgcgctccacgacccagaaaccggttccttcgaagcggtctgcaaatgcatgtccggg
ttcacggacaagtattacattgaaatgaaagacacactcgcaccggacgggataaataca
tccatgactaagagagcatactatgaggtcgccgatagcttgacaccagcgatttggttt
gagcctagggaagtgtgggaagtggcatttgcagatatcacagttagcccgacgtatact
gccgcagggcaatttatggaagggcgggggaaggggctgagtctgaggttcccgagattt
gtgaggaggagggaggataagggggttgaggaagctagcacgccggagtttttggctggt
ttgttttttaagcaggaaagggacagtgagagaattagtaaggcggcagtaggtggagag
aagaaaactgaagggatggaacaggatgctgaggttgatggccaagagttcttcaaaaac
atgagaggtgaaggcgctgggagtgatgtcaacttgtga

DBGET integrated database retrieval system