KEGG   Tuber melanosporum: GSTUM_00009579001Help
Entry
GSTUM_00009579001 CDS       T01282                                 

Definition
(RefSeq) hypothetical protein
  KO
K11422  histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
tml  Tuber melanosporum
Pathway
tml00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:tml00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    GSTUM_00009579001
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:tml03036]
    GSTUM_00009579001
Enzymes [BR:tml01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     GSTUM_00009579001
Chromosome and associated proteins [BR:tml03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     GSTUM_00009579001
   HMT complexes
    COMPASS/SET1 complex
     GSTUM_00009579001
    COMPASS/SET1 complex (yeast)
     GSTUM_00009579001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: N-SET SET SET_assoc RRM_1
Motif
Other DBs
NCBI-GeneID: 9184690
NCBI-ProteinID: XP_002840838
INRA: GSTUM_00009579001
UniProt: D5GKI6
LinkDB All DBs
AA seq 1200 aa AA seqDB search
MSRAGYADFFPAAPSVLAEKEKKRAQAERQDRRARNVPDDYDRESNAISVSDPGHIHSSS
CAPISVGVSLPSGHLVTTSTLTPTTTSSSPPPPLLSPSAGTTAKGDYPPNKLAAQSTSAR
EPYPLPPPPIPPPLAPLTPKGTPPAIKSDPSRRNWKVKYDPFLEKKSTTRKSREPILRWD
GEGITTPVTDPRLEVGRYTDGPKTGKKRLRSQGLYRTRWKWDENYIGPGPPSQILITGLS
PLTTETEISMHFRPHGDIQTLEIRIDPATGGSLGICSIIYRDGPRSRSPAHEAAKRAAQE
VNGSRVGIQRVRVELDRDGLKCKKLTGRILEEKRRKEAEAEKNRLKQPLNISYGELGSRP
RSPSARGSSPSRRDSRIDGRSDDRSRDQRPTPAPRPDNYRALDHVGRLPYIFITSRCIPG
DERYVRHLNGRLKNFGLKDILWDRTGFYVVFWERRDMERCFKVCDGDRLFSYTMIMEKHP
GSNRSPSPPPVARPELRKMGPNELVVEATNALMKDMKLVLMKDLRKRLAAPTIYDSLEVG
RFNKRRKVEEEEVQGITAGSHQVLAVSLEASIRSPTTLLPTLALKSTEKLTSAVAKSALQ
KPTALPRFKKRILTKAEDSSTPEASPLLHGSRTRLSKADARPLAHRLNQYNSDAGSDDES
TITENRPVSRGSRALSLDTGDDDSVSVALSANEGYRKRKRSVGPTSKLRDTAVSTDDEDH
SLEKDDGSQGLHDLKKPRIDHPRPYEDGEVFMGDEVDEEPAVATPHRTSTTTPQLKPITK
NKSRTIESDSEYYEDEMVFTKADPKDESELVNVLDDEDDRGPEIEIPNRTTLSREPRKRI
KTTESRTNRDLLAVPSFDADEEKHDSEMAGMDIEVSWGVSTTEGPMVTVQDDPDAILDID
SLQNLVKDAEDFKFLAQALAAVEPADLGNVQAWAYKEKQLKVAQKQSIARSQEKIEGFYR
PNPTGCARTEGYRRVPEAEKSMYLPHRLQLAAKVKSAANKIPEVTAAAVTNPTKNPSSTS
RMNRVNNRRLVVGLNNQKQMLSSDADVMRFNQLKKRKKPVKFARSAIHNWGLYAMENISA
GDMIIEYVGEIIRQQVADMREKKYLKSGIGSSYLFRIDDTTVIDATKAGGIARFINHSCT
PNCTAKIIKVEGSKRIVIYALRDIRENEELTYDYKFERELESEERIPCLCGSSGCKGFLN
NT seq 3603 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgcgcaggctatgccgacttcttccctgcagccccctcggttctggcggagaag
gagaagaagagagcacaggctgagaggcaagatagaagggctcgcaatgtccctgatgat
tatgatagggaatctaatgctatttccgtttctgatccgggccacattcactctagctct
tgtgctccaatttctgttggtgtttcattgccttccgggcatctcgttacaacatcgact
ctcacaccaactacaaccagctcctcacctcctccgccattgcttagtccctccgctgga
acaactgcgaagggcgattaccctccaaataaattggcggctcaatccacaagtgctagg
gaaccttatccgctaccaccaccacccattcctcctccactagcccccctgactccaaag
ggcacaccccccgctatcaagtctgatccttctcgcagaaattggaaagtcaaatatgat
ccattcctagagaagaaaagtaccacaaggaagagcagagaacctattttgcgttgggat
ggagaagggattacgacccccgtcacagacccccggctagaggttggacggtacaccgat
ggcccaaagactggcaagaaacggcttcggtcgcaagggctttataggacgagatggaaa
tgggatgagaattatattggacctggcccgccctcccagatcttgattacggggctatcc
cccctcacaactgagacggaaatctcgatgcactttagaccacacggggatattcaaaca
ttggagattcggattgaccctgcgaccggaggctctttaggaatatgttcaatcatttat
cgagatggtccaaggtccagatctccagcccatgaggctgcaaaaagagcagcacaggag
gttaacggttcaagagtaggaattcaacgagttcgggtagagttggatagagatgggctc
aagtgtaaaaagctgaccgggagaatacttgaggaaaagcgacggaaggaggcggaggcg
gagaagaatcggctcaaacaacccctcaacataagctacggggaattaggttctcggcca
cgctcgccgagcgcccgtgggagttcgccctctcgtcgagactcccggatagatggtagg
agtgacgatcggagccgggatcagcgtcctaccccagcaccgaggcctgataactacagg
gcactcgatcatgtcggaagactgccctatatatttatcacttcgcggtgcattcccggg
gatgagcgctatgttcgacatcttaacggtcggttaaaaaactttggtttgaaagacatc
ttgtgggatagaactgggttttatgttgtgttctgggaacggcgggatatggagcgttgt
tttaaagtttgcgatggagacaggctattctcctatacaatgataatggaaaaacacccc
ggcagtaatcggtcaccatctccgcccccggtagctcgacccgagctaagaaaaatggga
cctaatgagcttgtcgtggaagcaacaaatgccctaatgaaggatatgaaattagttttg
atgaaagatctgaggaaacgcttggctgccccaacgatttacgactcccttgaagttgga
aggtttaataaacggcgtaaggtggaggaggaagaagtacaaggaattactgcaggtagt
caccaggttctagccgtttctttggaagcaagcattcgctcaccgactacgctcttgcct
accttggctctcaaatccaccgaaaagctgacctcggcggtggcaaagtcggctttacag
aagccgactgcgcttccgcggtttaagaagcgaatattaactaaggcagaagattcaagc
acaccggaagcatctccattattacacggatctaggacgagactctccaaggcggatgcc
cggcctttagcacatcgattgaatcagtataattccgacgctggatcagatgacgagtca
actatcactgaaaataggcctgtttcccgggggtctcgtgccttatcactggataccggg
gatgacgattctgttagcgttgcactttcagcaaatgaaggatatcgaaaacggaaaagg
agcgttgggcctacctccaaacttagggatactgctgtttctacagatgatgaggatcat
agtcttgagaaagatgatgggtcgcagggtttacatgatctgaagaaaccccgaattgat
caccctaggccctacgaagatggggaggtgtttatgggggacgaggtagatgaggagcct
gctgttgccactccacatcgtacatccactaccactcctcaattaaagccgatcacgaaa
aataaatctcgaactatcgaaagtgatagtgaatactacgaggatgagatggtgttcacc
aaggcagatcccaaagatgagagtgaactggtcaatgtgctagacgatgaagatgataga
ggtccggagattgagatccccaataggactaccctgtcgagagaaccccgtaaaaggatt
aagactacggagtccagaaccaacagggatcttctcgctgtcccgtctttcgatgcggat
gaggagaaacatgatagtgagatggctggaatggacattgaggtttcatggggtgtttct
acaacagaaggcccaatggtcacagtccaggatgacccagatgctattcttgatatcgat
agcttgcaaaatctcgttaaggacgcggaagacttcaaatttttagctcaagccctggca
gctgtggagccggcagatttggggaacgttcaagcttgggcatataaggaaaagcaactg
aaagtcgcgcaaaaacaaagcattgcccgcagccaagagaaaatcgagggattttatcgt
cccaacccaacaggttgcgctcgcactgaaggttaccgccgtgtcccagaagccgaaaag
tcaatgtatcttccccatcggctccagctcgcagcaaaggtcaaatcagcagcaaacaaa
atcccagaagttaccgcagccgctgtcactaaccctacaaagaatccttcctcaacctca
cgcatgaaccgtgttaacaatcgtcgtcttgttgttgggttgaacaaccaaaagcagatg
ctgtcctccgacgcggacgttatgcgttttaatcagcttaagaagcgcaagaagcctgtc
aagtttgcccgctccgccatccataattggggtctatacgcgatggagaacatctccgct
ggtgacatgatcattgaatatgttggcgaaatcattagacagcaggtggcggacatgcgg
gagaagaagtatctcaagagtggaatcggtagttcctatcttttccgtattgacgatacc
actgttatcgacgctaccaaggcgggtggtatagccaggttcatcaaccatagctgtact
cccaattgcaccgcgaagattatcaaagttgagggaagcaagaggattgtcatctatgca
ttgagggatatccgcgaaaacgaggaactcacatacgactataagttcgaacgcgagctc
gagagcgaggagagaatcccatgtctttgcggatcaagtggttgtaagggcttcctcaat
tag

DBGET integrated database retrieval system