KEGG   Tuber melanosporum: GSTUM_00009772001Help
Entry
GSTUM_00009772001 CDS       T01282                                 

Definition
(RefSeq) hypothetical protein
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
tml  Tuber melanosporum
Pathway
tml00020  Citrate cycle (TCA cycle)
tml00190  Oxidative phosphorylation
tml01100  Metabolic pathways
tml01110  Biosynthesis of secondary metabolites
tml01130  Biosynthesis of antibiotics
tml01200  Carbon metabolism
Module
tml_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tml_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
tml_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:tml00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GSTUM_00009772001
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    GSTUM_00009772001
Enzymes [BR:tml01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     GSTUM_00009772001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C
Motif
Other DBs
NCBI-GeneID: 9183372
NCBI-ProteinID: XP_002840945
INRA: GSTUM_00009772001
UniProt: D5GKU3
LinkDB All DBs
AA seq 535 aa AA seqDB search
MHPDDWRWHMYDTVKGSDWLGDQDAIHYMTREAPASVIELENYGCPFSRTEDGKIYQRAF
GGQSQKYGKGGQAYRCCAAADRTGHALLHTLYGQSLRHNTKYFIEYFAMDLLMEDGECVG
VIAYNQEDGTLHRFRAHKTVLATGGYGRTYFSCTSAHTCTGDGMAMVARAGLPNQDLEFV
QFHPTGIYGAGCLITEGSRGEGGYLLNSEGERFMERYAPTAKDLASRDVVSRSMTLEIRN
GRGVGPDKDHIYLQLSHLPAEVLHERLPGISETAAIFSGVDVTKSPIPVLPTVHYNMGGI
PTRYTGEALTIDENGNDKVVPGLFAAGEAACVSVHGANRLGANSLLDLVVFGRAVAHTIR
DTLTPGTPLKPVSADIGAASIANLDKIRNSDGSKSTAQIRLDMQKTMQTDVSVFRTQESL
DQGVKKIQKVDASYHNLGIKDRSMIWNSDLVEALELGNLLTCATQTAHAAAARKESRGAH
AREDYPERDDENWMKHTLSWQKEQHGKVDLKYRAVVGNTLDEKECAAVPPFKRVY
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgcatcctgatgattggagatggcatatgtacgatacagtgaaaggatcggattggctt
ggtgaccaggatgctatccactatatgaccagagaagccccggcctcggtcattgaactg
gagaactacggatgtcctttttcgagaacggaggatgggaagatataccagcgtgcgttc
ggtgggcagtcacagaagtatggcaagggaggccaagcatataggtgctgcgccgcggca
gacagaaccggccatgccctcctacatactttatatgggcaatcactgagacataacaca
aagtatttcattgaatacttcgcaatggacctcctgatggaagacggtgagtgtgtgggc
gtcatcgcctacaaccaggaggatggcaccctccacaggttccgagcccacaagacagtc
ctagctaccggtgggtacgggcgtacgtacttttcctgcacttccgcccacacatgtacc
ggcgatggtatggcgatggtggctcgggccgggctgcccaaccaggatctggagttcgtt
caattccatccaaccgggatttacggcgcagggtgtttgattaccgagggatcccgcggc
gaaggtgggtacctattgaactctgagggtgagagattcatggagagatacgccccaact
gcgaaggatctcgctagtcgagatgtggtctccagaagcatgactctagaaattagaaac
ggcagaggtgttggtcctgacaaggaccatatataccttcaactaagtcatctgccagca
gaggttctccatgaacgcctccctggtatctcggagaccgcggccatcttctctggcgtt
gacgtcaccaagtcacccattccggtgttacccactgttcattacaatatgggcggtatc
cccacccgctacactggtgaggctttgactattgacgagaacggtaatgacaaagttgtt
ccaggccttttcgccgccggtgaggcagcttgtgtttcggtccacggtgccaaccgactt
ggagcaaattcacttcttgatctcgttgtttttggccgtgccgttgctcacaccatccgc
gacaccctaaccccaggaaccccgctaaagccggtatctgccgacattggcgccgcctct
attgccaacctagacaagatccgcaactcggacggctctaagagcaccgctcagattaga
cttgacatgcagaagactatgcagaccgacgtttcggtcttcaggacacaggaaagcttg
gaccaaggtgttaaaaagattcaaaaggtcgacgccagctatcataatttaggaattaaa
gaccgtagcatgatctggaactctgacctcgttgaggcacttgaacttggcaatcttctg
acgtgcgctactcaaaccgcacacgcggccgcggccagaaaggagtctcgtggagcgcac
gcaagagaagattaccctgaacgtgacgatgagaactggatgaagcatacactgtcgtgg
cagaaggagcaacacggtaaggtcgacttgaaataccgtgcagtcgttggaaatacccta
gatgagaaggagtgtgcggcggtcccgcctttcaagcgtgtatattaa

DBGET integrated database retrieval system