KEGG   Tuber melanosporum: GSTUM_00011853001Help
Entry
GSTUM_00011853001 CDS       T01282                                 

Definition
(RefSeq) hypothetical protein
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
tml  Tuber melanosporum
Pathway
tml00020  Citrate cycle (TCA cycle)
tml00480  Glutathione metabolism
tml01100  Metabolic pathways
tml01110  Biosynthesis of secondary metabolites
tml01130  Biosynthesis of antibiotics
tml01200  Carbon metabolism
tml01210  2-Oxocarboxylic acid metabolism
tml01230  Biosynthesis of amino acids
tml04146  Peroxisome
Module
tml_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tml_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:tml00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GSTUM_00011853001
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    GSTUM_00011853001
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    GSTUM_00011853001
Enzymes [BR:tml01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     GSTUM_00011853001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 9186664
NCBI-ProteinID: XP_002842233
INRA: GSTUM_00011853001
UniProt: D5GPI1
LinkDB All DBs
AA seq 478 aa AA seqDB search
MPLGATTSRCLLLRSRAIASTATIVARPPLLQCSTRVGKKENKAGSGIRLERLGNLHAFS
VSMERQEFQKIKVKNPIVELDGDEMTRVIWDWIKARFIHPYLDVDLKYYDLGILYRDKTE
DKVTVEAAEAILKHSVGVKCATITPDEARVKEFNLKKMWLSPNGTIRNILGGTVFREPIV
IPRIPRLVAGWKEPIIIGRHAHGDQYKAQDFVASGPGKLEMVYTPENGEPKRIQVFDYKA
SGVALAMYNTDDSISGFAHASFKLALQKKLPLYMSTKNTILKKYDGRFKDIFQNIYESTY
KTEFDAKGIWYEHRLIDDMVAQMIKSKGGFIMALKNYDGDVQSDIVAQGFGSLGLMTSVL
ITPDGKTFESEAAHGTVTRHYREYQKGKETSTNPIASIFAWTRGLIQRGTLDNTPDVVAF
AESLESAIIDTVQVDGIMTKDLALACGKQDRDSWVTTSIFLDGVEKRFKGSLKAKSIL
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgcctcttggtgctactactagccgctgtctgctgcttcgctctcgagcaattgcttct
actgctaccatcgttgccaggcctccgttgttacagtgctctacgagagtcgggaagaag
gagaacaaagctggttctggtataaggcttgaaaggcttggaaacctgcacgcgtttagc
gtcagtatggaaaggcaagagtttcagaagatcaaggtcaagaacccgattgtggaattg
gatggggacgagatgacacgggtgatttgggattggattaaggccaggttcattcatcct
tatctcgatgtcgacctcaagtactacgacttgggaattctatatcgggacaaaacagag
gataaagtcaccgttgaggctgcagaggcaatcttgaagcactctgtgggcgtcaagtgc
gcaaccatcactccggacgaagcacgtgtcaaggagttcaatctcaagaagatgtggctg
agtcccaacggaacgatccgcaatatcctcggcggaaccgtcttcagagagcccattgtc
atccccaggatcccccgcttggtagccggctggaaagagcccatcatcattggccgtcac
gcccacggcgaccagtacaaggcccaggactttgtcgcttctggcccaggtaaattggaa
atggtgtacactcccgagaatggtgagccgaagcgcatccaagtcttcgattataaggcc
agtggcgtcgcattggcaatgtataacaccgacgattcaatcagtggattcgctcacgct
agttttaagcttgcacttcagaagaagttgccgctgtacatgagcactaagaacactatt
ctcaagaagtacgatggaaggttcaaggatatttttcagaatatctacgagtcgacttac
aagactgagtttgatgccaagggtatttggtacgagcataggttgattgacgatatggtt
gctcagatgatcaaatctaagggcggcttcatcatggctctgaagaactacgacggagat
gttcagtccgacatcgtcgcgcaaggtttcggatcattaggactgatgacctccgtcttg
atcacccctgacgggaaaaccttcgagtccgaagcagcccacggaactgtaacaaggcat
taccgcgagtaccaaaaaggcaaggaaacctccaccaacccgatcgccagcatcttcgct
tggacccgcggcttaatccagcgtggcactctggataacaccccggacgtcgtcgccttc
gccgagtccctagagtccgccatcatcgacaccgtccaggtcgacggtatcatgaccaag
gacctcgcactcgcctgcggaaagcaggatagggactcctgggtcacaacaagtatattc
ctggacggcgtagagaagaggtttaaaggttcgctcaaggctaagtccattctttag

DBGET integrated database retrieval system