KEGG   Thermotoga maritima MSB8: Tmari_0014Help
Entry
Tmari_0014        CDS       T02663                                 

Definition
(GenBank) Pyruvate:ferredoxin oxidoreductase, alpha subunit
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
tmm  Thermotoga maritima MSB8
Pathway
tmm00010  Glycolysis / Gluconeogenesis
tmm00020  Citrate cycle (TCA cycle)
tmm00620  Pyruvate metabolism
tmm00633  Nitrotoluene degradation
tmm00640  Propanoate metabolism
tmm00650  Butanoate metabolism
tmm00680  Methane metabolism
tmm01100  Metabolic pathways
tmm01110  Biosynthesis of secondary metabolites
tmm01120  Microbial metabolism in diverse environments
tmm01130  Biosynthesis of antibiotics
tmm01200  Carbon metabolism
Module
tmm_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tmm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tmari_0014
   00020 Citrate cycle (TCA cycle)
    Tmari_0014
   00620 Pyruvate metabolism
    Tmari_0014
   00640 Propanoate metabolism
    Tmari_0014
   00650 Butanoate metabolism
    Tmari_0014
  09102 Energy metabolism
   00680 Methane metabolism
    Tmari_0014
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Tmari_0014
Enzymes [BR:tmm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Tmari_0014
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C TPP_enzyme_N Glycogen_syn
Motif
Other DBs
NCBI-ProteinID: AGL48940
UniProt: G4FGT3
LinkDB All DBs
Position
14138..15316
Genome map
AA seq 392 aa AA seqDB search
MERVVERVAVTGAEAVANAMRQIEPDVVAAYPITPQTPIVEYFARFVADGVVRTEMIPVE
SEHSAMSAVVGAAAAGARAMTATSANGLALMHEIVYIAASYRLPIVMPVVNRALSGPINI
HCDHSDAMAERDSGWIQLFAETNQEAYDFTILAVRLAEHEDVRLPVMVNLDGFILSHGVE
PVEFYPDELVKKFVGELKPMYPLLDTEHPVTWGPLDLYDYYFEHKRQQIEAMENVKKVFP
EIAKEFEETFGRKYWFVEPYRMEDAEHVMVALGSTNSTIKYVVDELREEGYKVGSLKIWM
FRPFPKEQLQELLNGRKSVVVLDRAVSFGAEAPLYEAVKSALYEVAARPMLGSYVYGLGG
RDIKPEHIRKAFEDAINGNLIADEQRYLGLRE
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggaaagggtcgtcgagagagtggccgtcaccggcgctgaggccgttgccaatgcgatg
agacagatagagcccgatgtcgttgcggcgtacccgatcactccacagacacctattgtg
gagtacttcgccaggttcgtcgcggacggcgttgtcaggacagaaatgattcccgtcgaa
agtgaacacagtgcgatgagcgctgtcgttggagccgctgccgcgggagcaagagcgatg
acagcaaccagtgcaaatggactcgcactgatgcacgaaatagtttacatcgctgcctcc
tacagacttcccattgtgatgcccgttgtgaacagagcgctcagtggtcctataaacatt
cactgtgaccacagcgacgcgatggcagaaagggattctggatggattcagctctttgcg
gaaactaatcaggaggcttacgatttcaccattctcgctgtgagactggcagaacacgaa
gatgtgagacttcccgtcatggtgaacctcgatgggttcatcctttctcacggagtggaa
cccgttgagttctatcccgatgaactcgtgaagaagttcgttggagagctcaaacccatg
tatcctcttctggatactgaacaccctgtaacctggggtcctctcgatctttacgattac
tacttcgaacacaaaagacagcagattgaagccatggaaaacgtaaagaaggtgttcccg
gaaatcgcaaaagaattcgaagaaacgtttggaaggaaatactggtttgtcgaaccgtac
agaatggaagatgcagagcacgtgatggtagcactgggctccacaaacagcacgataaag
tacgtggttgatgaactgagagaagaaggctacaaagttggatctttgaaaatctggatg
ttcagaccgttcccgaaggagcagcttcaggaactcctcaacggaagaaagagtgtagtt
gtgctcgacagagctgtttccttcggagcggaagcacctctctacgaagcagtgaaatct
gcgctctacgaagtagcagcgaggccgatgcttggatcctatgtctacggtctcggtgga
agggacatcaaaccagagcacatcagaaaagcgttcgaagatgccataaacggaaacctc
atagcagatgaacagagatatcttggtctcagagagtga

DBGET integrated database retrieval system