KEGG   Phaeoacremonium minimum: UCRPA7_1232Help
Entry
UCRPA7_1232       CDS       T03102                                 

Definition
(RefSeq) putative hexokinase protein
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
tmn  Phaeoacremonium minimum
Pathway
tmn00010  Glycolysis / Gluconeogenesis
tmn00051  Fructose and mannose metabolism
tmn00052  Galactose metabolism
tmn00500  Starch and sucrose metabolism
tmn00520  Amino sugar and nucleotide sugar metabolism
tmn01100  Metabolic pathways
tmn01110  Biosynthesis of secondary metabolites
tmn01130  Biosynthesis of antibiotics
tmn01200  Carbon metabolism
Module
tmn_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
tmn_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:tmn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    UCRPA7_1232
   00051 Fructose and mannose metabolism
    UCRPA7_1232
   00052 Galactose metabolism
    UCRPA7_1232
   00500 Starch and sucrose metabolism
    UCRPA7_1232
   00520 Amino sugar and nucleotide sugar metabolism
    UCRPA7_1232
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    UCRPA7_1232
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tmn04131]
    UCRPA7_1232
Enzymes [BR:tmn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     UCRPA7_1232
Membrane trafficking [BR:tmn04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    UCRPA7_1232
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 19321362
NCBI-ProteinID: XP_007912001
UniProt: R8BV43
LinkDB All DBs
Position
Unknown
AA seq 466 aa AA seqDB search
MHSKSSFADVPKDLLQEIKQLEEQFTVKPEKLKQITDHFVSELDKGLSVEGGSIPMNPTW
VMSFPDGYETGTFLALDMGGTNLRSKYRMPEELKTGDADELWEYIADCLQQFIETHHGED
QKMETLPLGFTFSYPATQNYIDEGILQRWTKGFDIDGVEGQNVVPMFEAALAQRGVPIKL
TALINDTTGTLIASAYTDTKMKIGCIFGTGCNAAYMENCGSIPKLAHMNLPPDCPMAINC
EWGAFDNEHKVLPRTKYDIIIDKDSPRPGQQAFEKMIAGLYLGEIFRLVMVDLHDNHEVS
IFQGQDIAKLRKAYTLDSSFLSAIEDDPFENLQETFDLFLDKLNLRPNLPELELIRRTAE
LIGTRAARLSACGVAAICKKKGYESAHVGADGSVFNKYPHFKARGAVALREILDWPEKKS
KKEEDPVEILAAEDGSGVGAALIAALTLKRVKEGNMAGILHPENFV
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgcattcaaagagttcctttgccgatgtccccaaggatctcctgcaggagatcaagcag
ctcgaggagcagttcactgtcaagccagagaagctcaagcaaatcactgaccatttcgtc
agcgagcttgacaagggccttagcgttgagggtggcagcattcccatgaacccaacttgg
gtaatgtcattcccagatggctatgagaccggcaccttcttggccctggacatgggtggc
acaaacctgcgttccaagtacagaatgcctgaggagctgaagactggtgatgccgatgag
ctttgggagtacattgccgactgtctgcagcagttcatcgagactcaccacggcgaagac
cagaagatggagacgctccctctaggtttcaccttctcatacccagccactcagaactac
atcgatgagggtattcttcagcgctggaccaagggctttgacatcgacggagtggagggg
cagaacgtggtccccatgttcgaggccgccctggcccagcgtggcgtgcctatcaagctt
accgcgttgatcaacgatacaactggtacccttatcgcctcggcctacactgacaccaag
atgaagattggatgtatcttcggaacgggatgcaatgcagcatatatggagaactgcggt
tcaattcccaagcttgcccacatgaacctgccccctgactgcccgatggctatcaactgt
gagtggggtgcattcgacaacgagcacaaggttctaccgaggaccaaatatgatatcatc
attgataaggattctcctcggccgggccagcaggccttcgagaagatgattgcgggtctg
tacctcggcgagattttccgcctggtcatggttgatcttcatgacaatcatgaagttagc
atcttccagggtcaagatatcgccaagctccgcaaggcctacacgctcgattcctccttc
ctctcggccattgaagatgatccgttcgagaacttacaggagaccttcgacctcttcctg
gacaagctgaacctccgtcccaacctacccgagctagagctcattcgccgaactgccgag
ttgattggcacgcgagcggcccgcctgtctgcctgtggtgtcgctgctatctgcaagaag
aagggatacgagtccgcccatgttggcgccgacggttccgtcttcaacaagtatccccac
ttcaaggcacgcggtgcggtggccctgcgcgagatcctggattggccggagaagaagagc
aagaaggaggaagaccccgtggagattcttgccgccgaggatggaagcggtgttggtgca
gcccttattgcggccttgacactaaagcgcgttaaggagggcaacatggccggaattctg
caccccgagaacttcgtctga

DBGET integrated database retrieval system