KEGG   Phaeoacremonium minimum: UCRPA7_159Help
Entry
UCRPA7_159        CDS       T03102                                 

Definition
(RefSeq) putative oxoglutarate dehydrogenase protein
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
tmn  Phaeoacremonium minimum
Pathway
tmn00020  Citrate cycle (TCA cycle)
tmn00310  Lysine degradation
tmn00380  Tryptophan metabolism
tmn01100  Metabolic pathways
tmn01110  Biosynthesis of secondary metabolites
tmn01130  Biosynthesis of antibiotics
tmn01200  Carbon metabolism
Module
tmn_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tmn_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:tmn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    UCRPA7_159
  09105 Amino acid metabolism
   00310 Lysine degradation
    UCRPA7_159
   00380 Tryptophan metabolism
    UCRPA7_159
Enzymes [BR:tmn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     UCRPA7_159
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transket_pyr OxoGdeHyase_C E1_dh 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-GeneID: 19321753
NCBI-ProteinID: XP_007910948
UniProt: R8BY63
LinkDB All DBs
Position
Unknown
AA seq 1051 aa AA seqDB search
MLRTSLSKAGSRVLRGASACSVSSCSSASRCFSTAAPRFSGAFSASRRPLSITTQKRYAS
ATANVPDPNDNFLSGNTANYIDEMYMQWKEDPKSVHVSWQVYFKNIENGDMPISQAFTPP
PTLVPSSSVVPGLAAGSGVGLGEGSDVTNHLKVQLLVRAYQARGHHKANIDPLGIRRESK
GSGNIQPKELSLEYYQFTEKDLDTEYTLGPGILPRFKREGREKMTLREIINACEKIYCGS
YGVEFIHIPDREKCDWLRERIEVPQPFKYSIDEKRRILDRLIWSSSFESFLATKYPNDKR
FGLEGCETLVPGMKALIDRSVDYGVKDIVIGMPHRGRLNVLSNVVRKPNESIFSEFAGTS
AAEDEGSGDVKYHLGMNFERPTPSGKRVQLSLVANPSHLEAEDPVVLGKTRAIQHYNNDE
KTHRTAMGVLLHGDAALAAQGVVYECLGFHSLPAYSTGGTIHLVVNNQIGFTTDPRFARS
TAYCTDIAKAIDAPVFHVNADDVEAVNFVCQLAADWRAEFQQDVIVDLVCYRKHGHNETD
QPSFTQPLMYKRIQSHDPQIDIYVEQLLKDGTFTKEDIEEHKQWVWGMLEDSFAKSKEYQ
PTSKEWTTSAWNGFKSPKELATEVLPHNPTGVDQKTLEHIGEVIGSAPEGFNVHRNLKRI
LSNRTKSVVEGKNIDWSTAEALAFGTLVTEGHHVRVSGQDVERGTFSQRHSVFHDQETED
TYTPLQHVSKDQGKFVISNSSLSEFGALGFEYGYSLTSPNALVMWEAQFGDFANNAQCII
DQFIASGEIKWMQRTGLVMSLPHGYDGQGPEHSSGRLERYLQLCNEDPRLFPSEEKLNRQ
HQDCNMQIAYMTTPANLFHILRRQMNRQFRKPLVIFFSKSLLRHPLARSDIEEFTGDSQF
HWIIPDPAHESGAIKSPEEIDRVILCSGQVYAALHKYRADNNINDVAITRVEQLHPFPWQ
QLKENLDTYPNAKTIVWAQEEPLNAGAWSFTQPRIETLLNQTQYHDRKHVMYAGRNPSAS
VATGLKASHTKEEQEFLKMAFSVKQDKLKGE
NT seq 3156 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgcacgtcgctgagcaaagctggcagccgggtgctgcgcggagccagtgcctgc
tctgtctcctcctgctcctccgcatcgagatgcttctcgactgccgctccccggttctct
ggagctttctctgcgagtcgccgtcctctatcgatcacgacccagaagaggtatgccagt
gccaccgccaatgttcccgatccgaacgacaacttcctctccggaaataccgccaattac
atcgatgagatgtatatgcaatggaaggaggaccccaagagcgtccatgtgtcatggcag
gtctacttcaagaatatcgaaaacggcgacatgcccatctctcaggccttcacgccccct
cctacccttgtgcctagctcttcggtcgtccccggactcgctgctgggtccggagttggc
ctcggtgaaggctccgatgtcacaaaccatttgaaggtgcaactactggtgcgcgcgtac
caggctcgtggtcatcacaaggcaaacatcgaccctcttggcattcgacgcgaatccaag
ggctctggaaacattcagcccaaggaactgagccttgagtactatcagtttaccgagaag
gatctcgataccgaatacactcttggccctggcatcttgccgcgattcaagagggaggga
agagagaagatgaccctgcgcgaaatcatcaacgcttgcgagaagatctactgcggctca
tatggtgttgaattcattcatatcccagacagagagaagtgcgattggttgagagagcgt
atcgaggtgcctcagccgttcaagtactcaattgacgagaagaggagaatcctggatcgg
ttgatctggagctccagctttgagtcatttctagccacgaagtatcccaacgacaagcga
ttcggtctcgagggttgcgagactcttgttcccggcatgaaggcactcattgaccgtagt
gttgattatggtgtcaaggatatcgttattggaatgccccatcgtggccgtctcaacgtg
ctcagcaacgttgtccgaaagccgaacgagtccattttcagcgagtttgccggcacatcc
gccgctgaagatgagggatccggcgatgtcaagtaccatctgggaatgaacttcgagcga
cccacaccctccggaaagcgcgtccaattatctctcgttgccaacccttcgcatctagag
gccgaggatcccgtcgtcttaggcaagacccgcgctatccagcactacaataacgatgag
aagacgcaccgcaccgcaatgggcgttttgctccatggtgatgccgcccttgctgcgcag
ggtgtggtgtatgaatgccttggtttccactctctaccagcttactcgaccggcggcacc
atccacttggttgtgaacaaccagatcggtttcaccactgatcctcgttttgcccgctcc
actgcgtactgcacggatatcgcaaaggcgattgatgctcccgtctttcacgtcaatgct
gatgatgtagaggctgtcaacttcgtctgccaacttgccgccgattggcgtgccgagttt
cagcaggatgtcatcgttgatctggtctgctaccgcaagcatggtcacaacgagacggat
cagccatcgttcactcaaccattgatgtacaagcgtatccagtcacacgacccgcagatt
gacatttatgtggagcagcttctcaaggatggtaccttcaccaaggaggacattgaagag
cacaagcaatgggtctggggcatgcttgaggacagcttcgccaaatccaaggagtaccag
ccaacgtcaaaggagtggaccacatccgcgtggaacggcttcaagtctccgaaggagcta
gctactgaagtcctgcctcacaaccctaccggtgtcgatcagaagaccttggagcatatc
ggtgaggttatcggctcagctcccgagggattcaacgttcaccgcaatcttaagcgtatt
ctttcgaacaggacgaagtctgttgtggagggcaagaacatcgactggtcaactgcggaa
gctctggcattcggtacactggttactgagggccaccacgtgcgtgtctctggccaggat
gtggagcgtggtactttctctcagcgccactctgtcttccatgaccaggagactgaagac
acttacacccctcttcagcatgtgagcaaggaccagggcaagtttgtcatctccaactcg
tcgctcagtgagtttggtgccttgggcttcgaatatggttactccctgacctccccgaac
gctctcgtgatgtgggaggctcagtttggcgactttgccaacaacgcccaatgtatcatt
gatcagttcattgcttcaggagaaatcaagtggatgcagagaactggccttgttatgtcg
ctgccccatggttatgacggccagggtccggagcactcgtccggtcgtcttgagcgctac
cttcagctctgcaatgaggacccgcgcctcttcccttcagaggagaagctcaaccgccaa
caccaagactgcaatatgcagattgcatacatgaccactccagccaacctcttccacatt
cttcgtcgccagatgaacaggcaattccgaaaacctttggtcatcttcttctcgaagtcg
ctcctgcgtcaccctcttgctcggtcggacattgaggagttcactggcgactctcagttc
cactggatcatccctgaccccgcgcatgagtctggtgcgatcaagtctccagaagagatt
gaccgtgtcattctgtgctctggccaggtttatgccgctctgcacaagtaccgcgctgac
aacaacatcaacgatgttgccattacccgtgtcgagcaacttcaccccttcccctggcaa
caactgaaggagaaccttgacacataccctaacgccaagaccatcgtctgggcccaggag
gagccgctcaacgccggtgcttggagtttcacacagcctcgtattgagacgcttctgaat
cagacccagtaccacgaccgcaagcacgtcatgtatgcgggccgaaacccgagtgcctct
gtcgccacaggtctgaaggcatcacataccaaggaagaacaggagttcctgaagatggct
ttcagcgtcaagcaggataagctcaagggagagtaa

DBGET integrated database retrieval system