KEGG   Phaeoacremonium minimum: UCRPA7_2028Help
Entry
UCRPA7_2028       CDS       T03102                                 

Definition
(RefSeq) putative glycoside hydrolase family 15 protein
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
tmn  Phaeoacremonium minimum
Pathway
tmn00500  Starch and sucrose metabolism
tmn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tmn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    UCRPA7_2028
Enzymes [BR:tmn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     UCRPA7_2028
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15 CBM_20
Motif
Other DBs
NCBI-GeneID: 19322238
NCBI-ProteinID: XP_007912796
UniProt: R8BSX0
LinkDB All DBs
Position
Unknown
AA seq 527 aa AA seqDB search
MRAFSSLLALGSFACQAVFGHPAELSKRVNVDTWLSTELPIARAQLLCNIGPNGCHSSGV
SSGLVIASPSTADPDYYYHWTRDAALVFKAIIDLFLEEYDADLQTNIQNYIVGQAKLQGV
SNPSGSLSDGSGLGEPKFLVNMGAFTGYIISNINGGSNRNGKDANSILTSIHNFDASLGC
DANTFQPCSDRALSNHKVVTDSFRSIYSINSGIAQGSAVAVGRYPEDSYYNGNPWYLNTF
AAAEQLYDALYVWKSQGSITVTSTSLAFFRDFVSSINTGTYASGSTTYNSIISAVTTYAD
GYINIGATYAQSNGSLAEQFSKSDGSPLSARDLTWSYASILSAAQRRRSVVPAAWANSAA
ISVPSNCYATSIQGSYTSATATSFPASQTPTTGVPTGTVSSSTTRATGSSSTSSTTSTAC
AAATSVAVTFNELVTTQYGQTIKIVGDIAALGGWDTSKAIALSADQYTSSNPLWRVTINL
TAGQVIQYKYINVASSGAVTWENDPNHTYTVPASCATAVTNSDSWQS
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgccttctcatctctcctcgccctcggcagcttcgcctgtcaggccgtctttggt
catccagcagagttgtcaaagagagtgaatgtcgatacgtggctcagcacggagctaccc
attgctcgggcccagctcctgtgcaacattgggcccaatggctgtcactcgtccggcgtg
agctctgggctcgttattgcctctccaagcacggcagacccggactattactaccattgg
actagagatgcagcactcgtgttcaaagcaatcattgatctgtttcttgaggagtatgat
gcagatctccagacgaacatccaaaattatatcgtcggccaggctaaactacagggcgtg
agcaatccgtctggatctctttctgatggatctggacttggagagccgaagttcctggtc
aatatgggagctttcactggttacattatctccaacatcaacggtggtagcaaccgcaat
ggaaaggacgccaactcaattttgacatccatccataattttgatgccagcctgggatgc
gatgccaataccttccaaccttgcagcgacagggccttgtctaatcataaggtcgttact
gactctttccgctcgatctactcaatcaatagcggaatcgctcagggttctgctgtcgca
gttggccgttaccccgaagacagctactacaacggcaacccgtggtatctgaacaccttt
gctgcggcagagcaactatatgatgccttgtacgtgtggaagagccaggggtctatcacc
gttacctcgacttcacttgcgttcttccgagacttcgtgtcatctatcaacacaggcaca
tatgcttccggctcaaccacctataactctatcatcagtgcggttaccacctatgcagat
ggatatatcaacatcggtgccacttatgcccaatccaatggctccctggcagagcaattc
tccaagtccgatggctcgcctttgtcggctagggacctcacatggagttatgcctcaatc
ttatcggcggctcagcgacgtcgctctgtcgttccggccgcttgggccaattctgccgct
atctcagttcctagcaattgctatgcaacttctatccaaggatcatacacctccgcgact
gctacaagcttccccgccagccaaactccgaccactggcgttcccaccggcaccgttagc
tcctcgacaacccgggcaactggatcttcatcaacatctagcacgacgtctaccgcatgt
gccgcggcgacttcagtcgcagtgaccttcaacgagctcgttacgacacagtatggccag
actatcaagatcgtcggcgatatcgccgcactcggcggctgggatacaagcaaagctatc
gcgctctcagccgaccaatatacatcttcgaacccgctatggagagttactatcaacctt
acggcgggtcaagtcatccagtacaagtatatcaatgtcgccagcagcggcgccgtgacc
tgggagaatgaccccaatcacacctatacggttcctgcgagctgtgccactgctgtgact
aactctgattcttggcagtcctaa

DBGET integrated database retrieval system