KEGG   Phaeoacremonium minimum: UCRPA7_3198Help
Entry
UCRPA7_3198       CDS       T03102                                 

Definition
(RefSeq) putative linoleate diol synthase protein
Organism
tmn  Phaeoacremonium minimum
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase p450
Motif
Other DBs
NCBI-GeneID: 19323523
NCBI-ProteinID: XP_007914022
UniProt: R8BPM7
LinkDB All DBs
Position
Unknown
AA seq 709 aa AA seqDB search
MQNTVRTFEKGRLKPDSFADKRLCGMPPGVGVLLIMFNRFHNHVAENLAAINEGGRFSEP
SPKLDDEKRAAALKKLDNDLFQTARLVTSGLYINITLVDYVRNIVNLNRCDTTWTLDPRQ
DMGRDAGTTKGAERGIGNVVSAEFNLCYRWHSCISAKDDLWVQQFYKELFGKPATEVNVQ
DLVMGFGKFEKSIPDDPAERTFGHFRRGSDGRFSDDDLVECISSAVEDCAGAFGAQNVPT
SMRPVEILGILQGRKWNVAGLNEFRKHFGLKPYERFEDINSDPQVADHLRHLYEHPDFVE
LYPGLVAEEAKSPMVPGVGIAPTYTISRVVLSDAVCLVRGDRYYTTDYNPRNLTNWGYNE
VQYDLSVNHGCVFYKLFIRAFPNHFKQNSVYAHYPMVIPSENHRILTSLGRVDKFDFSRP
TLVSPRVNITSYGAAKYILENQDKYKVTWHEGLSFLMGKGGARFMLSGDTPFHAGQRKCM
HNLLYKDDWHSHIKSFYAQITEQLLKEKSYIIGGHRQVDIIRDVGNIAHVHFASRVFNLP
LKTKDNLKGIYSEHEMYMVLALIFVTIFFDIDPVKSFPLRQATKTVCEQLGKLIETNVKI
TTGYGLRGLFSGSDKKDDPLAMYGTRMIKGLAKSGLNALLLGYAMEGIRLAGTFGSYREV
ATSDTIKEDDGREVPVKPGDRVFVSFVSAAKDPTHFPDPEVVVLLVKLP
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaacacggtacgaacgtttgaaaagggcagactgaaaccggacagtttcgcagac
aagcgcctttgcggcatgccgccgggagtcggggtgttattgatcatgttcaatcgattt
cacaaccatgttgccgagaacctggcggcaatcaacgaaggaggcagatttagtgagccc
tcgcctaaattggatgacgagaagagagccgctgcattgaagaagcttgacaatgatctt
ttccagactgcccgactggtcacgtctggtctctatatcaacatcacccttgttgattat
gtgcgcaatattgtgaatctgaatcgctgcgacacaacttggactcttgatcctcggcag
gatatgggccgggatgccggaaccactaaaggtgccgagaggggtattgggaatgtggtc
tctgcggagtttaacctctgctacagatggcattcttgtatctctgctaaagatgacttg
tgggtccagcaattctataaagaattgtttggcaagcccgctacagaggtgaacgtccaa
gatctggtaatgggctttggaaaattcgagaagtctatccctgatgatccggctgaaagg
acctttggacatttcaggcgaggatccgatggtcgtttcagtgatgatgaccttgttgaa
tgcatcagctcggctgtcgaagactgcgcaggtgcatttggagcacagaatgtcccgact
tccatgcgccctgtcgagatacttggcatacttcagggacgtaaatggaatgttgctgga
ctgaacgaatttcgcaagcattttggacttaagccatatgaacgcttcgaggatatcaac
tcagatccacaagttgctgatcatcttcgtcatctttacgaacatcctgactttgtcgag
ctttatcctgggttggtggctgaggaggcgaaatctcctatggttcctggcgtcggcatt
gctccaacgtacacgatctcgcgcgtggttctttccgacgcggtctgtctcgttcgtggg
gaccgctattatacaactgactataatcctcggaatttgactaattggggatacaatgag
gttcagtatgacctgagtgtgaaccacggatgtgtcttctacaagttattcattcgggca
tttcccaaccacttcaagcagaactcggtctatgctcactatccaatggtgataccttct
gaaaaccaccgcatcctgacaagccttggtcgcgttgacaaatttgatttttcacggccg
acgttggtatctcctcgagtgaatatcacctcatacggggcagcgaagtacatcctggaa
aatcaagacaagtacaaggtgacgtggcatgaagggctgtccttcttgatgggcaaaggt
ggagcccgtttcatgctatctggcgatacgccgttccatgctggccaacgaaagtgcatg
cacaacttgttatacaaagatgattggcattcacatatcaagtcattctacgcccagatt
actgagcaactcttgaaagaaaagagttatatcattggcggtcatcgacaagtagatatc
attcgcgatgtcggcaatattgctcatgttcacttcgcatcccgagttttcaaccttccc
ctgaagacaaaagataatttgaagggtatctactcagagcacgagatgtatatggttctg
gcacttattttcgtcaccatcttctttgacatcgacccggtgaagtccttcccgctccga
caagcgacgaagacggtatgcgagcagctaggtaaacttatcgagacgaatgtcaagata
accacgggctatggtctgcgaggtcttttctcgggatctgataagaaagacgaccctctc
gcgatgtatggcactcgtatgatcaaaggcttggcaaaatcaggcctgaatgcactgctg
ctcgggtatgctatggaaggcatccgactagctggcacctttggctcctatcgagaagtt
gccacatctgatacaatcaaggaggatgatggtcgtgaggtcccagtcaagccgggtgat
cgcgtctttgttagcttcgtctcagcagccaaggatccaactcacttcccggatcctgaa
gtggtcgtgctgctagtcaagttgccctaa

DBGET integrated database retrieval system