KEGG   Phaeoacremonium minimum: UCRPA7_3753Help
Entry
UCRPA7_3753       CDS       T03102                                 

Definition
(RefSeq) putative glycoside hydrolase family 31 protein
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
tmn  Phaeoacremonium minimum
Pathway
tmn00052  Galactose metabolism
tmn00500  Starch and sucrose metabolism
tmn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tmn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    UCRPA7_3753
   00500 Starch and sucrose metabolism
    UCRPA7_3753
Enzymes [BR:tmn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     UCRPA7_3753
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Rotavirus_VP7
Motif
Other DBs
NCBI-GeneID: 19324132
NCBI-ProteinID: XP_007914427
UniProt: R8BN20
LinkDB All DBs
Position
Unknown
AA seq 986 aa AA seqDB search
MALSGSPGAFAQTSTLSSPSQTTSWREIFTVPSDADTGATLLPNIRDPEAVDSQTACPGY
LASSVQTNASGLTADLNIAGPACNVYGNDIANLTLSVEYQASGRLHVEIKPRYIGAGNET
WFILPEALVPKPVVEEENATEAASDFAFSWTNEPTFGFTVTRKSNADVLFTTNGTRLVYA
DQFIEFVSALPDEYNLYGLGEVIHGFRLGNNLTRTLFAADVGDPIDQNIYGQHPIYLDTR
YYSTGEDGEETYAANATNTSASYTSYTHGVFLRNAHAQEILLRPSNITWRTLGGTVDLYF
YSGPLAEDVTTSYQLSTVGLPAMQQYWTFGFHQCRWGYENWTRLQEVVDNFANANIPLET
IWTDIDYMNQYRDFENDQLRFGYSEGAEFLAKLHANGQHYVPIVDSAVYAPNPENASDAY
PIFDRGIDADAFMLNPDGSLYIGAVWPGYTVFPDFIGAVLNGTGAIEWRVKEMGIWYQNV
SFDGIWIDMSEVSSFCVGSCGSKNRTLNPVHPPFSLPGEPGNLVLDYPEGFNLTNATEAS
SASSAKSAQATPAPSSSSTSTTYLRTTPTPGVREINHPPYVIDNVQGDLAVHAVSPNATH
HGGTQEYDFHGLFGYEILNATYQALIGLAPTKRPFIIGRSTFAGSGKWAGHWGGDNQSLW
AYMVFSISQALSFSVFGIPMFGVDTCGFNGNSDMELCSRWMQLSAFFPFYRNHNVLAAIS
QEPYVWSAVAEASRSAMAIRYALLPYMYTLFALAHDSGSTVMRALAWEFPSEPWLANADR
QFLLGDALMVTPVLVQGAETVDGVFPGVGDGRTVWYDWYNHSAIVDVTPGQNITLDAPLG
HIPLFVRGGYVLPLQEPAMTTTKSRESPWGVLAALDQQGAASGRLYLDDGESVEPNATTW
VEFLATNTSLSAQPTGNFTELNPLANITVLGVSNRVSQITFNGEPLKCGSAKWNSTTKAL
TLTGLTDLTPHGAFNETWELKWKLSS
NT seq 2961 nt NT seq  +upstreamnt  +downstreamnt
atggccttgtccgggagcccgggcgcatttgctcagacctcgactctttcaagcccaagt
caaacgaccagctggcgggaaatattcaccgtgccctctgatgctgacacgggagctaca
ctcctcccaaacatccgggatcccgaggctgttgactcccaaacggcttgccccggatat
ctagcatcaagcgtccaaacaaatgcctctggtctgacagcagacctaaacattgccggc
ccagcatgcaatgtgtacggcaacgacatcgcgaacctgaccctgagcgtggagtatcag
gcctctggcagactccatgtcgagatcaagccgcggtacatcggcgccgggaacgagacg
tggttcatcctgccagaggcgctcgtcccaaagcctgttgttgaggaggagaatgccacc
gaggcagccagtgactttgccttcagctggacgaacgaacccacctttggcttcacggtg
acgaggaagtcgaatgccgatgtgctgttcactacaaatggcacaaggctcgtgtatgca
gatcaattcattgaatttgtgtcggcgttgccggatgagtataatctttacgggctcggc
gaagtgattcatgggtttcggctgggaaataacctcacgagaactttgttcgcagctgac
gtaggtgacccgattgatcagaatatatacgggcagcatccaatatacttggacacgcgt
tactacagcaccggtgaagatggtgaggaaacatatgcagcaaacgccacgaacacatca
gcctcgtacacatcatacacccacggcgtgttccttcgcaatgcccatgcgcaagagatc
ctcttgaggccgtccaatatcacctggcggactttgggaggcactgttgacctctatttc
tactctggtcccctggccgaggatgtcaccacgtcgtaccagctcagcaccgttggcctg
cctgctatgcagcagtattggacctttgggtttcaccagtgcagatggggctatgaaaat
tggacacgactacaagaggttgtggataatttcgccaatgctaatattcccctagagact
atctggaccgacatcgactatatgaaccagtaccgtgactttgaaaatgatcaactccga
tttggctacagtgaaggtgccgagttcttggctaagctacatgccaacggtcagcattat
gtcccaattgtggactctgcggtttatgctcccaacccagagaacgccagtgatgcgtat
cctatttttgatcgtggcattgatgccgatgctttcatgctgaatcctgatggatcactg
tatattggagcagtgtggccagggtatacagtcttcccggatttcattggagccgtacta
aacggtaccggcgcgattgagtggcgggtaaaggagatgggtatctggtatcaaaacgtc
tcctttgacggcatctggatagacatgtctgaagtgtcgtccttctgtgtggggagctgc
ggtagcaagaaccgcaccctgaacccggttcacccccctttcagcctgccaggagagccg
ggcaatctggtgctcgattacccagaaggattcaatttgaccaacgccacggaggcctcg
tccgcatcgtcagctaagtctgctcaagccactcctgctccgagctcatcctcgacttcc
acgacgtatctccgcacaacaccaacgccgggagttcgtgagatcaaccaccctccctat
gtcattgacaatgttcaaggcgacctcgcagtacatgccgtatcaccaaatgccacgcac
cacggcgggacgcaagaatacgattttcatgggcttttcggatatgagatcttgaacgct
acataccaagcattgatcggcctagcgccaacaaaacggccatttatcatcgggcgctca
accttcgccggcagcggcaaatgggcaggacattggggcggcgacaaccagtcgctctgg
gcgtatatggttttctcgatctcccaagcactcagcttctccgtcttcggcatcccaatg
ttcggcgtggatacgtgcggcttcaacggcaacagcgacatggagctctgcagccgctgg
atgcagctgagcgctttctttcccttctaccgtaatcataatgtcttggcagcaatcagc
caggagccgtacgtatggagtgccgttgcggaggcgagccgctctgcgatggcgattcgg
tacgcattgctgccgtacatgtacacgctatttgcactggcgcatgactccgggtcaacg
gtgatgcgggctctggcatgggaattcccctctgagccttggctggctaatgccgatcgg
caattcctactgggagacgcgctcatggtgacgccggtgctggtccagggggccgagacg
gtcgatggtgtcttccccggcgttggcgatggccgaacggtctggtacgactggtacaat
cacagcgctattgtggatgttactccaggccaaaatattactctggatgcgcccctggga
catattccgctgttcgtccgcggcggctacgtcctgccattgcaagagccggccatgaca
accacgaagtcccgcgaaagtccgtggggagtgcttgctgcgcttgaccagcaaggagcg
gcctcaggacgtctatatctggatgatggtgagagtgtggagcccaatgctacaacatgg
gttgagtttctcgcaacaaatacctccctgtccgcccaaccaacaggcaattttacagag
ctcaacccgctggcaaatataacagtgcttggcgtatccaaccgagtatcccaaatcact
ttcaatggagagccgctcaagtgcggttcggcgaagtggaacagcacaacgaaggcgttg
actctgacgggcctaacggacttgacgcctcacggggcgttcaacgagacctgggagctt
aaatggaagttgtcgtcgtaa

DBGET integrated database retrieval system