KEGG   Phaeoacremonium minimum: UCRPA7_3867Help
Entry
UCRPA7_3867       CDS       T03102                                 

Definition
(RefSeq) putative repressible alkaline phosphatase precursor protein
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
tmn  Phaeoacremonium minimum
Pathway
tmn00730  Thiamine metabolism
tmn00790  Folate biosynthesis
tmn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tmn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    UCRPA7_3867
   00790 Folate biosynthesis
    UCRPA7_3867
Enzymes [BR:tmn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     UCRPA7_3867
Exosome [BR:tmn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   UCRPA7_3867
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:tmn00537]
 Enzymes
  UCRPA7_3867
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme
Motif
Other DBs
NCBI-GeneID: 19324258
NCBI-ProteinID: XP_007914641
UniProt: R8BMT4
LinkDB All DBs
Position
Unknown
AA seq 578 aa AA seqDB search
MTSARTPLLASSRRSQDSERSDRQAEAEDDALHGESTQHQHRFLPDGPWAIRLREIIIFI
WALLATAAVIILAVWTQHRQQTSPYVKPSGKRNLVFMVSDGMGPASLSLTRSFRQLVDDL
PYSDTLTLDQHFWGTSRTRSTNSLVTDSAAGATAFSCGKKSYNGAISMLPDYTPCGTVLE
AAKRAGYKTGLVVTTDITDATPACFASHVRIRAENDAIALQEIGDGVLGRMVDLMLGGGR
CRFLPNTTEGSCRADDIDVAKIAQEKHGWTYHDDRAGFDSMALGKNVSLPVLGLFADHDV
PFELDRRNMADVYPSLSEMATTALRALEDATKDSDQGFFLMIEGSRIDHAGHINDPAAQV
REVLEYDKTFKTVVDFLDKSKSQGVLVATSDHETGGLVTARQNPNELPVYNWYPAVLANA
NASAEHLSRQLLEHIDQTNSNPDSTEDLIDWINTHLVINGLGITDALEDELKIVASYPEA
SVTTLSKMISVRARVGWSTHGHSAVDVNVYSSGGPGTDKIRGNIENTEIGKFLREYLSVD
VDAITKELNKKTDSIPQYASRAEQNGYETEGLPMEWVM
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atgacttccgccaggacaccgctcctggcatcctcccgccgctctcaagactccgagcga
tcggaccgtcaagcagaggccgaagacgatgctctgcacggcgaatccacacaacaccag
caccgtttcctccccgatggcccctgggcgatccgactccgcgagataatcatctttatc
tgggcgcttctggccacggccgctgtgatcattctcgcagtatggacccaacatcgccag
cagacgtcgccatacgtcaagccttcagggaagcgcaacctggtcttcatggtgtcggat
ggcatgggcccagcgtcgctttcactgacacgctcgtttcgccaactcgtcgacgaccta
ccatacagcgacaccctcacgctagaccagcacttctggggcacgagccggacccgatcg
acgaatagcttggtgacggattccgcggcaggcgcaacggcgttctcatgcggcaagaag
agctacaacggagccatttctatgcttcctgactacaccccatgcggcaccgtgcttgag
gcagcgaaaagagctggatataagacaggactagttgtgacaacagatatcacagatgct
acgcccgcctgttttgcaagtcacgtacgcatacgagcagagaatgacgcgattgcactg
caagagattggagacggcgtactgggccgcatggtagacctgatgctgggaggaggcaga
tgtcgtttcttgccaaacacaacagaaggaagctgccgcgccgacgacatcgatgtggcc
aaaattgcgcaggagaagcacggctggacctatcatgacgaccgcgctggcttcgacagc
atggcactaggcaagaacgtctcgctacccgtgctcggcctttttgcagatcatgacgtt
cctttcgagctggaccgccgtaacatggcagatgtctacccgagtctgagcgaaatggcc
acgactgcattgcgggcgttggaggatgctaccaaagacagcgaccaaggattcttcctt
atgatcgaaggaagcagaattgaccatgccggccatatcaatgacccagctgcacaggtc
agagaagtcctggagtatgacaagactttcaagactgttgtggactttctggataagagt
aagagtcagggcgtcttggtcgccacgagcgatcatgagactggcggcctcgttactgca
cggcaaaatccgaacgaacttcccgtgtataactggtatcctgcggtcctggcaaatgcc
aacgcatcagcagagcacctatctcgtcagcttcttgagcatatcgatcagactaattcc
aaccctgactccactgaagaccttattgactggatcaatacacatctagtcattaacgga
cttggcatcactgatgccctcgaggatgaattgaagattgtggcatcgtatcccgaagca
tcagtgacaactctctccaagatgatcagcgttcgagctcgtgttggctggagcactcat
ggccactcggctgtggatgtcaatgtatacagctccggaggcccaggaacagacaagatc
cgtggcaacatagaaaacacggagattggtaagtttctgcgggaatatttgagcgtggac
gttgatgccatcacaaaagagctcaacaagaagaccgattccattccacagtatgcgagt
agagcggagcagaacggatatgagactgaggggcttcccatggaatgggttatgtag

DBGET integrated database retrieval system