KEGG   Phaeoacremonium minimum: UCRPA7_6330Help
Entry
UCRPA7_6330       CDS       T03102                                 

Definition
(RefSeq) putative histone h3 lysine 36 methyltransferase protein
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
tmn  Phaeoacremonium minimum
Pathway
tmn00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:tmn00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    UCRPA7_6330
Enzymes [BR:tmn01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     UCRPA7_6330
Chromosome and associated proteins [BR:tmn03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     UCRPA7_6330
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SRI SET WW Med26
Motif
Other DBs
NCBI-GeneID: 19326975
NCBI-ProteinID: XP_007917059
UniProt: R8BFQ2
LinkDB All DBs
Position
Unknown
AA seq 961 aa AA seqDB search
MEDEERIPDAISVMKLEGESTGRPDAKVKHERASASATPNGSKPTSRSPSMADLKTEGDG
ESKQDIEPTPKLSRKSSSKTASHSARLYDHLPNVTEESCTHFQVITDCLYGSKHMGSSDH
DALDCDCSEEWRDGQNHACGEDSDCINRATKMECVDGDCNCGAGCQNQRFQRKEFANVSV
IKTEKKGFGLRADSDLQANDFVFEYIGEVINEPTFRRRMVQYDEEGIKHFYFMSLTKSEF
VDATKKGNLGRFCNHSCNPNCYVDKWVVGDKLRMGIFAGRKIKAGEELVFNYNVDRYGAD
PQPCYCGEPNCTGFIGGKTQTERATKLPPATIEALGIDDGDGWDTAVAKKPRKKKPNEDD
EEYVNSVQPRGLGEDGVTKVMAALMQCKEKWIAVKLLTRIQAADDDRVRNRVVRMHGYQI
LKTTLVTFLDDNNVVLQILDILDKFPRLTKNKISDSKIEATIESLTSSDHEDVAAESKRL
LDEWSKLETAYRIPRKKFDPTAPAANSFEERRNLDRVEEVTTTKPLSPFLSSVVIPKGPR
SNVPQRNVNFFNGQRPPRRPHPGYTLPLGWFSATDSRGNTYYYNKAGTTTWKRPTAPAPE
TPKAPSKAVQDQKALQDIIDSLTKDPTPKPSASQTPQPVGTPVQEPKKEKWRSLPLEKQM
KIYENTLFPHVKYVLDKFRHRLPKEQLKKFAKEVNKKLVASDYKNNRVEDPTAISSKQEK
KVKKYVKDFLDRAVEKYKEHERRKAERAARHAANGTKPSTAAGEDLASSETPVGHDEVEA
IDDLIMSDVDDVQSPGSSPERKRKREDENSPSLTPSETPSVKRLKEEDVEPSPPPPPPPP
PEAAMDVAMAEEEEAFVRENEEAQRLADEAEQDRARQEEALQRENEEAMREFEMEQKSKQ
DLGNDAAITHPAINGEGLSKTDLPNGTIMEAEDMELDANANDGGAVKSHERQARKQEVLS
H
NT seq 2886 nt NT seq  +upstreamnt  +downstreamnt
atggaggacgaggagcgcatacccgacgcgatcagcgtcatgaagctggagggtgaatcg
accggaaggcctgacgcaaaggtcaagcacgaacgagcgagcgcttctgctacgcccaac
ggctccaaaccgacgtctagatctcccagtatggcagatctcaagacggaaggcgacggc
gaatccaagcaagacattgagcccacacccaagctatctaggaaatcatcctctaagact
gccagtcactctgctcgtctctacgaccatcttcctaacgtcaccgaggaatcatgtacc
catttccaagttatcaccgactgtctgtatgggtcaaagcacatgggatcttcggatcac
gatgctctagactgcgactgcagcgaagaatggcgggacggacagaaccacgcttgtggc
gaggactctgattgtatcaacagggccacgaaaatggaatgtgtcgatggcgactgcaat
tgcggagctggatgtcagaaccagaggttccagcgaaaagagtttgctaacgtgtctgtc
atcaagaccgagaagaagggcttcggtctcagggccgacagcgacctacaggccaacgac
ttcgttttcgaatacattggcgaagtcatcaatgagccgaccttccgcaggcgcatggtc
cagtacgatgaagagggcatcaagcacttttactttatgtcactgaccaagagtgagttt
gttgacgccaccaagaagggcaatctggggcgattctgcaatcactcctgtaaccctaat
tgctacgtggacaaatgggtggttggcgacaagctgcgcatgggcattttcgccggccgt
aaaatcaaagcgggcgaggaattagtgttcaactacaacgtggacaggtacggcgctgat
ccacaaccctgctactgcggcgagcccaactgcactggctttatcggagggaagacgcaa
acagagcgtgccaccaaactgccccctgcgacaattgaggccctcggcatcgatgatggc
gatggctgggacactgcagtcgctaagaaaccccgcaagaagaagcctaatgaagacgat
gaggagtacgttaacagcgtgcaaccccgcggcctgggcgaggacggcgtcacgaaagtc
atggcagcgctcatgcagtgcaaagaaaaatggattgcagtcaagctgctcacccgaatc
caggctgcagacgatgatcgcgttcggaatcgtgtggtgcgcatgcacggttaccagatc
ctcaaaaccacactggtcactttcctggacgacaacaatgttgttctacaaattctcgac
atcctcgacaaatttccccgcttgaccaagaacaagatctccgactccaagatagaagcg
acaattgagagtctcacgtcgtctgaccacgaggatgtggcagccgagtcgaagcgcctc
ctggatgagtggagcaaattggagacggcgtatcgaattcctcgaaagaaattcgacccc
accgcaccggccgccaactcgttcgaggagcgtcgcaaccttgaccgtgtagaggaagtc
accaccacaaagcccctttcgccattcttgagcagtgtggtaatcccaaaaggaccgcgc
agcaatgttccccaacgaaacgtgaattttttcaatggtcagcggccaccgcgcagaccg
catcccggctacaccttaccgttgggatggttttctgctaccgattcccggggcaacaca
tactactataacaaagctggaacgacgacctggaagagaccgacagcaccagccccagaa
accccgaaagccccatccaaagccgtgcaagatcaaaaggctcttcaagacatcattgat
agcttgacaaaggatcccacacccaaaccttctgcttcgcaaactccacaacccgtcgga
actcctgtgcaggagccaaagaaggaaaaatggcgttctctgcctctagagaagcagatg
aagatctatgagaacacacttttcccccacgtgaagtatgtgttggacaagtttcggcac
agacttcccaaggagcagctgaagaaattcgcaaaagaggttaacaagaagcttgtggct
tctgactacaagaacaaccgagtagaggatcctactgccatctcctctaagcaagagaag
aaggtcaagaagtacgtcaaagacttcttggaccgagctgtcgagaagtataaagagcat
gagaggagaaaggccgagcgcgcagcaaggcacgctgctaacggcacgaagccctctact
gcagcaggtgaggatctggccagcagcgagacgcctgttggccatgatgaagtcgaagcc
atcgatgacctcataatgagtgatgtagacgatgttcagtcaccaggtagttctcctgag
cggaagcgtaagagagaagacgagaactcgcccagcctgacgccatctgagaccccatca
gtcaaacgactgaaggaggaggacgtcgagcctagtcctccacccccacccccaccaccg
cccgaggccgctatggacgttgccatggcggaagaggaggaggcctttgtgagggagaac
gaggaggcgcagcggcttgccgacgaagctgagcaggatagagcccgccaggaggaggcg
ttgcagcgcgagaacgaggaggccatgagagaattcgaaatggagcagaagagcaagcag
gacctcggcaacgatgccgcgatcacgcacccggccatcaatggagagggcctgtccaag
acggacctaccaaatggcaccatcatggaggcggaggacatggagttggacgcaaatgcg
aatgatggtggcgccgtgaagagccatgagcgtcaggcacgtaagcaggaggtcctaagc
cattag

DBGET integrated database retrieval system