KEGG   Phaeoacremonium minimum: UCRPA7_6556Help
Entry
UCRPA7_6556       CDS       T03102                                 

Definition
(RefSeq) putative glutathione transferase protein
Organism
tmn  Phaeoacremonium minimum
SSDB OrthologParalogGFIT
Motif
Pfam: CK_II_beta GST_N_3 GST_N_2 GST_N GST_C_2 Glutaredoxin DUF5053 GST_C_5
Motif
Other DBs
NCBI-GeneID: 19327224
NCBI-ProteinID: XP_007917284
UniProt: R8BF62
LinkDB All DBs
Position
Unknown
AA seq 966 aa AA seqDB search
MGSEKAFWLVVPDLEADVFHADLQRLQDSFGHSHHQNTTHHAFDGSPHTHSAPSPVHGLP
LARPHLPSQAESPRLPARLGGVGPGAGLSAAPHGRPSVPELQASAPPPPNGHARGQFGIL
TPTTVPSHGAVVRIQQEEEDDGYAAATQGSVEAAGGDGPGQQARSNSQLSTKIVVNPPNL
RDWREKLFNVDDMIILSHEEFETYFPHIDNVYSHRSTQKYKRKPFVSHYWDCRMKGRPPG
TPKSDDPNKKKRKRHARERDLCDVKIKITEYFAGATLNMLDMGSSGEGMPSLPPSTFSSA
GTDGQRFWTIQRVNGNGGNGKGDGVAGPHKHTLEKSDEIKKSSVQRWVASQEKEAKKTQK
AFQRKPTGAAGVTAKKHLKDSDMKLYAACFCPFSQRVWIALEAKGLPYQYCEIDPFKKPQ
QLLEANPRGLVPAIRKGDWACGESAVILEYLEDLDSRIRLYPTEPRLKANCRLWIDHINS
RIVPSFYYLLHAGDPEKQNEGIEKLQYDITALVQAADEQGPYFLGPGLCLVDIHFAPFAI
RLSSILKPLREWTDAAPGTRWQQWVDALENNHHVQATTSNRELYIETMELLLNSRPPEKR
RMRFPCWWDRHQDLRQYFMLDPNEAPIVPFLDVRGEAGRGPDQNDDDGTITERGTPEPGS
TTTDSDHGPSDDDAPGPAVATPDLTADNSSRAPTDEAPTPADTVMDEFVSESDSDYTSYW
RDWFISSRGNEYFCEIDEDYLTDRFNLTGLNTEVQYYQYALDLVTDVFDLDCDDEMRETI
EKSARHLYGLVHARYIVTTRGLAKMLEKYKKADFGKCPRVMCNSHPLLPMGLSDIPNLKP
VKLYCARCEDTYNPKSSRHATIDGAYFGTSFHNILFQVYPALIPAKSAERYTPRVYGFKV
HAPAALIRWQNGQRDEMRRRLRKMEVESGFKDDNVEDEPEEDEEDEELDFEEGGQTGLVQ
PGDVMQ
NT seq 2901 nt NT seq  +upstreamnt  +downstreamnt
atgggctcagagaaggcattttggttggttgtcccggacctcgaggctgatgtcttccac
gccgacctacagcgtctgcaagactcattcggccactcccaccaccaaaacaccacccat
cacgcctttgacggctcgccgcacactcactccgctccgtcccccgtgcatggcctcccg
ctcgcacgacctcacctcccctcccaagccgaatctccaagactgcctgcccgccttggc
ggcgtgggcccaggtgctggcttgagtgctgcccctcatggtcgaccatccgtccccgag
ttgcaggcttctgccccgcccccgccaaacggccatgcccgtggccaattcggcatcctg
accccgactaccgtcccgtcgcacggtgccgtcgtgcggatccagcaggaagaggaggac
gatggatatgccgccgccacgcagggctcggtggaggctgccggtggtgacgggcctgga
cagcaagctcggtcgaatagccagctgagcaccaagattgtggtgaatccgccaaacttg
cgagactggcgcgagaagctcttcaacgtggacgacatgatcatcctcagccatgaggag
tttgagacctacttcccccacatcgacaacgtgtattcccaccggtcgacgcaaaaatat
aagagaaaacctttcgtctcccactactgggactgtcggatgaaaggccggccgccaggt
accccgaaatcagacgacccgaacaagaagaagaggaaaaggcacgcacgagagcgagac
ctctgcgacgtcaagatcaagatcacagaatacttcgcgggtgcgaccttgaacatgctg
gatatgggctcttcaggggaaggcatgccgtctttgcccccctcaacgttctccagcgcg
gggactgatgggcagcgtttctggacgatacagcgagtcaatggaaacggcggtaacgga
aaaggagatggcgtggctggaccgcacaagcacacactggagaagagcgacgagatcaag
aagagcagcgtgcaacgatgggtagcaagccaggagaaggaggcaaagaagacccagaag
gccttccaacggaagccgacaggcgctgctggagtgacagcgaagaaacacttgaaggac
agtgatatgaagctttatgcggcctgtttctgtccgttctcgcagcgagtgtggattgcc
ttggaggccaaagggttgccatatcagtactgtgagatcgacccctttaagaaaccacaa
cagctcctagaggcaaacccaagaggcctggtcccagcaatccggaagggagactgggca
tgcggagagagcgccgtgattttagagtatctggaggatctcgacagtcgcatacggctc
tacccgactgagccccgcctaaaagccaattgcaggttgtggatcgaccatattaattca
aggatcgtgccatcattctactatcttctccacgcgggcgacccagagaagcagaatgaa
ggcatcgagaagctccagtatgatataactgcgctggtccaagctgcagatgagcagggc
ccttatttccttgggccaggcttgtgccttgttgatatccacttcgcaccttttgcgatc
cggctctcgagcatattgaaacccttgcgcgagtggactgatgcggcaccaggcacacga
tggcaacaatgggttgatgccctagagaacaaccatcatgtgcaggcaactacgagcaac
agggagctgtatattgagactatggagctgctgctaaatagccgcccgcctgagaagcgt
cgcatgcgcttcccgtgctggtgggatcgccatcaggatctgcgacagtattttatgttg
gatccgaatgaggcgcccatcgtgcctttcctggatgttcgaggagaggccggccgagga
ccggatcaaaacgacgacgacggaacgattaccgagcgtggcacccccgagcctggctcc
actaccaccgactctgatcacggcccgagcgacgacgatgcgccgggtcccgcagtggct
acgcccgacctgacggcggacaactcgagccgcgctcccaccgacgaagctcccaccccc
gccgacaccgtgatggatgaattcgtgagcgagagcgacagtgactacaccagctactgg
cgcgactggttcatctcctcccgaggcaatgagtacttctgcgagatcgatgaggattat
ctcaccgaccgattcaacctgacgggactgaacacggaggtgcagtactaccagtacgcc
ctggacttggttaccgatgtcttcgaccttgactgcgacgacgagatgcgcgagaccatc
gagaagtccgcccgccacctgtacggccttgtccatgcgcgctacattgtcaccacgcgt
ggcctggctaagatgctcgagaagtacaagaaggccgacttcggaaagtgccctcgcgtc
atgtgcaactcccatcccctgctgccgatgggcctctccgatatccccaacctcaagccc
gtgaagctgtactgcgcgcgctgcgaggacacctacaaccccaagtcgagccgccacgct
accatcgatggcgcctacttcggcacttccttccacaacatcctcttccaggtctacccg
gcgctgatccccgccaagtccgccgagcgctacaccccgcgcgtctacggcttcaaggtc
cacgcccccgccgcgctcatccgctggcaaaacggccagcgcgacgagatgcgccgccgc
ctccgtaagatggaggtcgagtccggcttcaaggacgacaacgtcgaggacgagcctgag
gaggatgaggaggatgaggagctcgactttgaggagggcggccagaccggcctggtgcag
ccgggagatgtcatgcagtag

DBGET integrated database retrieval system